KEGG   Haloferax mediterranei: HFX_0123Help
Entry
HFX_0123          CDS       T02129                                 

Gene name
gpmB
Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:hme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hme00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:hme00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hme00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124197..124817
Genome map
AA seq 206 aa AA seqDB search
MVSFVRHAHSPYIPDAERSRGLSRRGRRDAARITAHLADVADVVATSPYKRARATVEGVS
DAAGVPLVVDEDLRERELAGEHVEDFDTAVEHLWANPTASHPGGESHSEAQARGVAAVDR
LVEAYPDRHVAVGTHGTLMALVFNAYDPRYGYEFWDGLSMPDVYEVTFVDDNPLSIVRTW
VPPDERSDVGDRDPTAGVGDADGSDF
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtggtttcgttcgtccggcacgcccactcgccgtacatcccggatgccgaacggagccgt
ggtctctcgcgtcgaggacgccgcgatgccgcccgcatcaccgctcacctcgccgatgtc
gctgacgtggtcgccacgagtccgtacaagcgtgcccgggcgaccgtcgaaggcgtctct
gacgctgccggcgtcccgctggtcgttgacgaggaccttcgcgaacgcgaacttgcagga
gaacacgtcgaggacttcgataccgccgtcgaacacctctgggcgaaccccacggcgtcc
caccccggcggtgaatcacactccgaagcacaggcccgcggcgtggcggcggtggaccga
ctcgtcgaagcctaccccgaccggcacgtcgccgtcgggacccacgggacgctcatggcg
ctcgtgttcaacgcctacgacccgcgctacggctacgagttctgggatggactctcgatg
cctgacgtatacgaagtgacattcgtcgacgacaatcccctcagcatcgttcggacgtgg
gttcccccggatgaacggtctgacgtgggcgaccgcgacccgacagcaggggtcggcgat
gcggatggctccgatttctga

DBGET integrated database retrieval system