KEGG   Haloferax mediterranei: HFX_0123Help
Entry
HFX_0123          CDS       T02129                                 

Gene name
gpmB
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hme  Haloferax mediterranei
Pathway
hme00010  Glycolysis / Gluconeogenesis
hme00260  Glycine, serine and threonine metabolism
hme00680  Methane metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01130  Biosynthesis of antibiotics
hme01200  Carbon metabolism
hme01230  Biosynthesis of amino acids
Module
hme_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_0123 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    HFX_0123 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0123 (gpmB)
Enzymes [BR:hme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HFX_0123 (gpmB)
Membrane trafficking [BR:hme04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HFX_0123 (gpmB)
Exosome [BR:hme04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HFX_0123 (gpmB)
  Exosomal proteins of melanoma cells
   HFX_0123 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AFK17865
UniProt: I3R0V5
Position
124176..124817
Genome map
AA seq 213 aa AA seqDB search
MTTPATTVVSFVRHAHSPYIPDAERSRGLSRRGRRDAARITAHLADVADVVATSPYKRAR
ATVEGVSDAAGVPLVVDEDLRERELAGEHVEDFDTAVEHLWANPTASHPGGESHSEAQAR
GVAAVDRLVEAYPDRHVAVGTHGTLMALVFNAYDPRYGYEFWDGLSMPDVYEVTFVDDNP
LSIVRTWVPPDERSDVGDRDPTAGVGDADGSDF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgactacccctgcgacaactgtggtttcgttcgtccggcacgcccactcgccgtacatc
ccggatgccgaacggagccgtggtctctcgcgtcgaggacgccgcgatgccgcccgcatc
accgctcacctcgccgatgtcgctgacgtggtcgccacgagtccgtacaagcgtgcccgg
gcgaccgtcgaaggcgtctctgacgctgccggcgtcccgctggtcgttgacgaggacctt
cgcgaacgcgaacttgcaggagaacacgtcgaggacttcgataccgccgtcgaacacctc
tgggcgaaccccacggcgtcccaccccggcggtgaatcacactccgaagcacaggcccgc
ggcgtggcggcggtggaccgactcgtcgaagcctaccccgaccggcacgtcgccgtcggg
acccacgggacgctcatggcgctcgtgttcaacgcctacgacccgcgctacggctacgag
ttctgggatggactctcgatgcctgacgtatacgaagtgacattcgtcgacgacaatccc
ctcagcatcgttcggacgtgggttcccccggatgaacggtctgacgtgggcgaccgcgac
ccgacagcaggggtcggcgatgcggatggctccgatttctga

DBGET integrated database retrieval system