KEGG   Haloferax mediterranei: HFX_0370Help
Entry
HFX_0370          CDS       T02129                                 

Gene name
nagC
Definition
(GenBank) glucokinase (EC:2.7.1.2)
  KO
K00845  
glucokinase [EC:2.7.1.2]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_0370 (nagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_0370 (nagC)
   00052 Galactose metabolism
    HFX_0370 (nagC)
   00500 Starch and sucrose metabolism
    HFX_0370 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    HFX_0370 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HFX_0370 (nagC)
   00524 Butirosin and neomycin biosynthesis
    HFX_0370 (nagC)
Enzymes [BR:hme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HFX_0370 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
347862..348830
Genome map
AA seq 322 aa AA seqDB search
MAYYVGVDLGATNVRSVVADDEGTVLGQSRDRTPRGPTGIAVTEAVLGVVREACDEAGID
PSEAVAAGIGAIGPLDLAEGAVENPANLPDTIDRIPLTGPISVLLDTDEVYLHNDTNAGV
IGERFHSDRNPDDMVYLTISSGIGAGVCVDGHIIDGWDGNAGEVGHMTLDPHGFMTCGCG
HDGHWEGYCSGNNIPKYARELHEEDPVETALPVENPTFSAVDVFEHAGKDDFADHVISQL
GHWNAMGVANIVHAYAPLIIYVGGAVALNNPDLVLDPIREQMSNMVMSNIPEIQLTTLGD
EVVVEGALASAMTAGTGDRSRL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtactacgtgggcgtcgacctgggggcgacaaacgtccgttcggtggttgccgac
gacgagggaacagtcctcgggcagtcccgtgatagaactccacgcgggccgacaggtatc
gcagttaccgaggcagtgctcggcgtcgtccgtgaggcatgtgacgaagcgggtatcgac
ccgagcgaggcagttgccgccggtatcggcgcgattggtccgctcgacttggctgagggt
gcagtcgagaacccggcgaacctcccggacaccatcgaccggattccgttgaccggtccg
atttcggtgctcctcgatacggacgaagtgtacctccacaacgacaccaacgccggcgtc
atcggcgagcggttccactcggaccggaaccccgacgatatggtgtatctcactatctcc
tccggtatcggtgcgggtgtctgtgtggacgggcacatcatcgatgggtgggacggcaac
gccggtgaagtcggtcacatgacgctcgacccccatggcttcatgacgtgtgggtgtggt
cacgacggacactgggagggctactgttcggggaacaacatcccgaaatacgcccgcgaa
cttcacgaagaagaccccgtcgaaaccgcgttgccggtagaaaacccgacgttctccgca
gtggacgtgttcgaacacgctggcaaggacgacttcgccgaccacgtcatcagccaactg
ggccactggaacgcgatgggcgtcgccaatatcgttcacgcgtacgccccgcttatcatc
tacgtcggcggcgcagtcgcactcaacaaccccgacttggtgttggacccaatccgagaa
cagatgagcaacatggttatgtcgaacattcctgagattcaactcacgacgctcggcgac
gaagtggtcgtcgagggtgcactcgcaagtgcgatgaccgctgggaccggagaccgctca
cggctgtaa

DBGET integrated database retrieval system