KEGG   Haloferax mediterranei: HFX_0436Help
Entry
HFX_0436          CDS       T02129                                 

Gene name
thrC4
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hme  Haloferax mediterranei
Pathway
hme00260  Glycine, serine and threonine metabolism
hme00750  Vitamin B6 metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01230  Biosynthesis of amino acids
Module
hme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0436 (thrC4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HFX_0436 (thrC4)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HFX_0436 (thrC4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Radical_SAM OprD
Motif
Other DBs
NCBI-ProteinID: AFK18171
UniProt: I3R1R1
Position
406508..407611
Genome map
AA seq 367 aa AA seqDB search
MTAPSNLPSRLRLACDSCGSTFDEWRWRCSCGAPLDFDSTPTPTSPTPDDADLDYRRGLW
AFDDFLPPTPQATLGEGMTPLVDASEWEASFKLEYVFPTGSFKDRGATTTLSVASELGVE
RIVEDSSGNAGAAIATYAARAGIDAEIYVPASVKPAKVRAIERAGAKPVRIEGTRQDVTD
ACVEAVEEGNAWYASHAWNPAFFAGTATVAYEIAAQRDWTAPDAVVTPLGHGTLFLGAYR
GFRDLYEAGWIDRIPELYGAQAAGYSPIADARHHTTTETNDVADGIQIRNPVRETEIHEA
LDETGGDAIALSADAVEDELDRLHRHGFYTEPTCAVAPAALRELRLSGVLTMDDDVVVPL
TGSGLKS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccccctccaatcttccgtcccggcttcgactcgcgtgtgattcgtgcggttcg
accttcgatgagtggcgctggcggtgttcctgcggcgcaccgctcgacttcgattctacc
ccgacccccacgtctccgacgcccgacgacgccgacctcgactaccgtcgcggtctctgg
gcgttcgacgactttctcccgccgactccacaggccactctcggcgaggggatgactccg
ctcgtggacgcctcggagtgggaagcctcgttcaaactggagtacgtcttccccaccggg
tcgttcaaggaccgcggcgcgacgacgactctctccgtcgcgtcggaactcggcgtcgag
cgaatcgtcgaagattcctcgggcaatgcgggggccgccatcgcaacctacgccgcccgc
gccggtatcgacgcggagatttacgttcccgcgtcggtcaagcccgcaaaagtccgtgcc
atcgaacgcgccggggcgaagccggttcgaatcgaaggtactcgacaggacgtaaccgac
gcctgcgtcgaggcagtcgaagagggcaatgcgtggtatgcaagtcacgcgtggaacccg
gcattcttcgcggggacggcaactgtcgcctacgaaatcgccgcccagcgggactggaca
gcacccgacgctgtcgtcacgccactgggccacgggacgctctttctcggggcgtatcgc
ggcttccgcgacctctacgaggccggctggattgaccggattcccgaactatacggcgcg
caggccgcaggatactcccctattgccgacgctcggcaccacacgaccaccgagacgaac
gacgtggccgacggcatccagattcggaaccccgtccgcgaaacggagattcacgaggcg
ctcgacgagacgggcggcgacgcaatcgcgctctcggccgatgcggtcgaagacgaactc
gacagactccaccgtcacggattctacaccgaaccgacgtgcgccgtcgcacccgcggcg
ctccgcgaactccgactgtcgggcgtcctcaccatggacgacgacgtggttgtgccgctg
acggggagcggactcaagtcttaa

DBGET integrated database retrieval system