KEGG   Haloferax mediterranei: HFX_0438Help
Entry
HFX_0438          CDS       T02129                                 

Gene name
pimT_2
Definition
protein-L-isoaspartate O-methyltransferase pimT1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hme  Haloferax mediterranei
Brite
Enzymes [BR:hme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HFX_0438 (pimT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(408302..409036)
Genome map
AA seq 244 aa AA seqDB search
MDYSVLREDMVDGLEHSLGPLPEAVGLAMRSVPRHEFVTDSPYQNRPTEHRETNTTILAP
TTVARLLSALDPEPDDNVLVVGAGVGYTAAVLAEIVGDSRVHAVDITRKLVYEARENLQR
AGYEGVLVDCRDGAEGLSDYAPFDRILVEASAVRPPRRLLSQLADGGRLVMPKGVGEQTL
VAIEDGEVAETFGPLTFKPLLVDGEQTGSIVRNRTRREDPEYEGRSWHAGHGWEQDWIDW
EARR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggactactcggtgctgcgcgaagacatggtcgacgggttggagcactcgctcggcccg
ctccccgaggctgttggcctcgcgatgcgcagtgtcccgcgccacgagttcgtcaccgac
tcgccgtatcagaaccgcccgaccgaacaccgcgagacgaatacgaccatcctcgcgccg
acgacagtcgcccgcctgctctctgcgctcgaccccgaaccggacgacaacgtgctcgtc
gtcggtgcgggcgtcgggtacacagccgccgtcctcgccgaaatcgtcggcgactcccgc
gttcacgcggtggacatcacgcggaagctggtctacgaagcccgcgaaaacctccagcgg
gcgggctacgaaggcgttctcgtggactgccgagacggtgcggaggggctatctgactac
gcaccgttcgaccgcattctcgtcgaagcctcggcggtcaggccaccacggcggcttctc
tcacaactcgccgacggcggccgactggtcatgccgaaaggtgtcggtgagcagacgctc
gtcgctatcgaagacggtgaggtggcggagacattcggcccactcacgttcaagcccttg
ctcgtcgatggtgaacagaccggcagcatcgtccgaaatcggacgcgccgtgaagacccc
gagtacgagggccgcagctggcacgccgggcacgggtgggaacaagactggattgactgg
gaagcgcgtcgctga

DBGET integrated database retrieval system