KEGG   Haloferax mediterranei: HFX_0444Help
Entry
HFX_0444          CDS       T02129                                 

Gene name
gapA
Definition
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_0444 (gapA)
   01230 Biosynthesis of amino acids
    HFX_0444 (gapA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_0444 (gapA)
Enzymes [BR:hme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     HFX_0444 (gapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414679..415773
Genome map
AA seq 364 aa AA seqDB search
MVAYGCFSFMIRVGVNGYGTIGKRVADAVEAQPDMELIGVAKTQPNFEAHTAVERGYPMY
AAIPERSPLFAEAGIDIAGEVDELVAEADVIVDCTPSGIGAQNRELYETHHTPAIFQGGE
DSDVADVSFNARSNFDAARDADYVRVVSCNTTGLSRIIAPLEEEYGVDKVRATLVRRGGD
PGQNSRGPINDILPNPIKVPSHHGPDVKTIFPDLEIDTLGLKVPATLMHVHALNVTLEDD
VTGAHVRQLLEGEDRVYVIPEGLGIDGAGKLKDFALDAGRPRGDMWENCVWGESIGVNGR
DLYLFQAIHQESDVIPENIDAIRAMFDTEDKRDSMELTDRTLGVGISGDPSGFSEQARAE
FADD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcctatggctgtttttcattcatgatacgagtgggtgtcaacggctacggtacg
atcggaaagcgcgtcgcagacgcagtcgaggcgcaacccgatatggaactcatcggcgta
gccaagacgcaacccaacttcgaagcacacaccgcggtcgaacgcgggtacccgatgtac
gccgccatcccagaacgttctccattgttcgccgaagccggcatcgacatcgctggcgaa
gtggacgaactcgttgccgaggcggacgtcatcgtggactgtacgccgtccggtatcggc
gcgcaaaaccgcgaactgtacgaaacacaccacacacccgctatcttccagggtggcgag
gactccgacgtggcggacgtgagcttcaacgcgcggtcgaacttcgatgcggcccgcgac
gccgactacgtccgtgtcgtctcgtgtaacacgaccggtctctcgcgcatcatcgcgccg
ctcgaagaggagtacggcgtcgataaggtacgtgcgacgctcgttcgtcgtggcggcgac
ccgggacagaactctcgcggaccgataaacgacattctcccgaacccgatcaaagttccg
tcccaccacggtcccgacgtgaagaccattttccccgacctcgaaatcgatacgctcgga
ctgaaagtcccggcgacgctgatgcacgtgcacgcgctcaacgtcacgctcgaagacgac
gtgaccggcgcacacgtccgccaactgctcgaaggcgaggaccgcgtctacgtcattccg
gaaggcctcggcatcgacggcgcggggaagctcaaggacttcgcactcgacgcgggtcgc
ccgcgcggcgacatgtgggagaactgcgtctggggcgaatccatcggcgtcaacggccgc
gacctctacctgttccaggccatccaccaggagtccgacgtgattccggagaacatcgac
gccatccgcgcgatgttcgacaccgaagacaaacgggacagcatggaactcacggaccgc
acgctcggcgtcggcatctccggcgacccttctgggttctctgagcaggcgcgcgcggag
ttcgccgacgactaa

DBGET integrated database retrieval system