KEGG   Haloferax mediterranei: HFX_0447Help
Entry
HFX_0447          CDS       T02129                                 

Gene name
gapA
Definition
glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) (EC:1.2.1.12)
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:hme01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hme01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hme00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(417858..418910)
Genome map
AA seq 350 aa AA seqDB search
MSEKSYLSAGENVDESDVVRVALNGFGRIGRNIFRAVLDNPKVELVAINDVMDFDDMAYL
AKYDSVMGRLDGVERDGDSLTIGGTSVGLYNVQSPAELPWGDLDVDVALECTGIFRTKKD
ASAHLDAGADKVVISAPPKGDEPVKQIVYGVNHDEYDGEDIISNASCTTNSVTPVAKVLD
EEFGIENGLLTTVHAYTGSQNLIDSPHAKQRRGRSAAENIVPTTTGAAQAATEILPQLDG
KLDGMAIRVPVPNGSLTELVVQLDETPSVEEINDAFRAAADSGPLAGVLGYTDDEVTSRD
ILQLPFSSTVDLNTTNQVNDGGLYKILTWYDNEYGFSNRMLDVAHFVTHQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaatcctacctcagcgcgggcgagaacgtggatgaatcggacgtggtgcgg
gtggcactcaacggcttcggccgaatcggccggaacatcttccgtgccgtcctcgacaat
ccgaaggttgaactggtcgccatcaacgacgtcatggacttcgacgacatggcgtacctc
gcgaagtacgattccgtcatgggccgtctcgacggtgtcgaacgcgacggcgactccctg
actatcggcggcacctcggtgggtctctacaacgtccagtcccccgcagaactgccgtgg
ggagacctcgacgtcgacgtggcactcgaatgtacgggcatcttccgtacgaagaaagat
gcctcggcgcacctcgacgcaggcgcggacaaggtcgtcatctccgcaccgccgaagggc
gacgagccggtcaagcagatcgtctacggtgtcaaccacgacgagtacgacggcgaagat
atcatctccaacgcctcctgtacgacgaactccgtcacaccggtcgcaaaggtgctcgac
gaggagttcggcatcgagaacggtcttctgacgaccgtccacgcctacacgggcagccag
aacctcatcgacagcccccacgcgaagcagcgtcgcggtcgctccgctgccgagaacatc
gtcccgacgacgaccggtgccgcacaggcagccaccgagattcttccccagctcgacggc
aagctcgacggcatggcgattcgcgtccccgtcccgaacgggtcgctcacggaactcgtc
gtccaactcgacgagacgccttcggtcgaagaaatcaacgatgccttccgcgccgctgcc
gactccggcccgctcgccggtgtcctcggctacacggacgacgaagtcacgtcgcgtgac
attctccagcttcccttctccagcaccgtcgacctcaacacgacgaaccaggtcaacgac
ggcggtctctacaagattctgacgtggtacgacaacgagtacggattctccaaccggatg
ctcgacgtcgcacacttcgtcacgcatcagtaa

DBGET integrated database retrieval system