KEGG   Haloferax mediterranei: HFX_0746Help
Entry
HFX_0746          CDS       T02129                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hme  Haloferax mediterranei
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hme01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hme00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702399..703124
Genome map
AA seq 241 aa AA seqDB search
MRAILDAARERPGGDTRLSVDSRPFPDAVAATADAGRVPVIAEVKPTSPTTDGVRDDDPV
ELAREMVGGGATALSVLTEPEHFGGSTESLRRIREAVDVPVLRKDFILREEQLDAVESDL
ILLIARFVGEDLPDLVAAARNRGFQPLVEVHTREELTAALAAGADIIGVNNRDLGKLEVD
LGTFEELAPEAPDDVLLVAESGVKTTDDVRRMREAGADALLVGTAIMDGDVRQNTENLTT
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccattctggatgccgcacgggagcgaccgggcggcgacacacgtctttcggtc
gactcgcggccgtttccggacgccgtggccgcgacagcggatgccggtcgggttccggtc
atcgccgaagtgaagcccacgagtccgacaacggacggtgtccgagacgacgacccagtc
gaactggcccgcgagatggtcggcggcggcgcgacagcgttgtcggtgctcaccgaacct
gaacacttcggcgggtcaacggagtcgcttcgacgtatccgcgaggctgtcgacgtgccc
gtactacggaaggatttcatcttgcgcgaggagcaactcgacgcggtcgagtcggacctt
attctccttatcgcgcggttcgttggtgaagacctcccagacctcgttgcggcggcccgc
aaccgcgggttccaaccgctcgtcgaggtgcacacgcgtgaagaactcaccgcggcgctc
gcggcaggcgcagatattatcggcgtcaacaatcgtgacctcgggaagcttgaagtcgac
ctcggaacgttcgaggaactcgcacctgaagctcccgacgacgtgcttctcgtcgcggag
agtggcgtgaagacgaccgatgacgttcggcggatgcgcgaggccggtgccgacgccctc
ctcgtcgggaccgccatcatggacggcgacgtgcgacagaatactgaaaatctaacaaca
caatga

DBGET integrated database retrieval system