KEGG   Haloferax mediterranei: HFX_0747Help
Entry
HFX_0747          CDS       T02129                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hme  Haloferax mediterranei
Pathway
hme00260  Glycine, serine and threonine metabolism
hme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01130  Biosynthesis of antibiotics
hme01230  Biosynthesis of amino acids
Module
hme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0747 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFX_0747 (trpB)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFX_0747 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFK18470
UniProt: I3R2L0
Position
703121..704395
Genome map
AA seq 424 aa AA seqDB search
MSVDGKFGDYGGQYVPEALMPAIEELNDAYERYVLNNEDGFMDDFRARLRDFGGRPTPLQ
RAGRLSKRYGREVYLKREDLVHGGAHKLNNALGQVLLAKYMGKERIIAETGAGQHGTATA
MACAHLDIPCEIYMGKRDINRQRPNVFRMKLNGSEVNPVTVGRGTLKEAISETMRDWATN
VEDTHYVIGSVVGPHPFPSMVRDFQAVISEEARTQAHEQMGRLPDAVIACAGGGSNTMGA
FAEFVEDDETSLYAVEAGGSTLEVDEEAGVAPNSASLTTGSEGILHGARTLLLQDRDGQI
MESHSVSSGLDYAGVGPELAHLVDTGRVTAVNVDDDEALTAFHRLSQLEGIIPALETAHA
FGYLEQVAGPDAPADSDEEADDLGEFVVVNVSGRGDKDLESAIEETYERDIDIAPNMDEF
TGGL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagacggcaaattcggcgactacggcggacagtacgttcccgaggccttgatg
ccggccatcgaggaactgaacgatgcgtacgagcggtacgtcctgaacaacgaagacggc
ttcatggacgacttccgcgcacgattgcgggacttcggcggacgaccgacgcctctccag
cgcgccggccgtctctcgaagcggtacggccgcgaggtctacctcaagcgagaagacctc
gtccacggcggcgcacacaaactcaacaacgccctcgggcaggtcttgctcgcgaagtac
atgggcaaggaacgaatcatcgcggagacgggcgcgggccagcatggtactgccacggcg
atggcttgcgcgcacctcgacatcccctgcgaaatctacatgggcaaacgcgacatcaac
cgacagcgacccaacgtcttccggatgaaactcaacggctcggaagtcaacccggttacc
gtcggtcgcggcacgctcaaggaggccatctccgagacgatgcgcgactgggcgaccaac
gtcgaagacacgcactacgtcatcggctccgtggtcggcccgcaccccttcccgagcatg
gttcgggacttccaggcggtcatctccgaggaagcgcggacgcaagcccacgagcagatg
ggacgactccccgacgccgtcatcgcgtgcgctggcggcgggtcgaacacgatgggcgcg
ttcgccgagttcgtggaggatgatgaaaccagcctctacgccgtcgaagccggcggttcg
acgctcgaagtcgacgaagaagcgggtgtcgcccctaattcggcctcgctcacgaccggc
agcgaaggaatcctccacggcgctcgaaccctcctcttgcaggaccgcgacggccagatt
atggagtcgcattcggtctcgtcgggtctcgactatgccggtgtcggcccggaactcgca
cacctcgtcgataccggtcgcgtcaccgccgtcaacgtcgacgacgatgaagccctgacc
gcattccaccgtctctcccagttggagggcatcattcccgcgttggagacggcccacgcc
ttcggttacctcgaacaggtcgcaggtcccgatgctcccgcagacagcgacgaagaggcc
gacgacctcggcgagttcgtcgtcgtcaacgtctccggccgcggcgacaaggacctcgaa
tcggccatcgaggagacctacgagcgcgacatcgatatcgcgccgaacatggacgagttc
acggggggactgtaa

DBGET integrated database retrieval system