KEGG   Haloferax mediterranei: HFX_0748Help
Entry
HFX_0748          CDS       T02129                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hme  Haloferax mediterranei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFX_0748 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0748 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFX_0748 (trpA)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFX_0748 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
704395..705228
Genome map
AA seq 277 aa AA seqDB search
MSLEDAFADGPAFIPYLAAGDPDYESSLEYVEALERGGADIIELGLPFSEPVAEGPTIQN
AVVRSLESGMTPTRFFEFVEDLDVSVPLVCMTYYNLIYRYGDNSGPRPFVEKAADVGIEG
FVVPDLPAEESDPLREACDEFGLDLVFIVAPTTRGERLERIMQQVSGYVYVQARLGTTGA
QTSVSDQTDSSLARLSEYDVPKAVGFGISSGDHAERIVRSGADGIIVGSALVDIVAAGHE
DGDDPGTVADRLETLARELKEGALSGASQRPPHSERT
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcgaagacgccttcgccgacggcccggcgttcattccgtatctcgccgccggc
gacccggattacgagtcctccctcgaatacgtggaggcgctcgaacgcggcggcgcggat
attatcgaactcggcttgcccttctccgaacccgtcgcggaggggccgaccatccagaac
gcggtcgttcgctcgctcgaaagcggcatgacgccgacgcgattcttcgagttcgtcgaa
gacctcgacgtgtcggtgccgctcgtctgtatgacctactacaacctcatctaccgctac
ggtgataactccggcccgcgcccgttcgtcgagaaggcggccgacgtcggcatcgaggga
ttcgtcgttcccgacctgcccgccgaagagtccgacccgctccgcgaggcgtgcgacgag
ttcggtctcgacctcgtgttcatcgtcgcgccgacgacccgcggcgagcgtctcgaacgc
atcatgcagcaggtctctgggtacgtctacgtccaggcgcgactcggcacgaccggcgcg
cagacgagcgtctccgaccagactgattcgtcgctcgcccgcctgagcgaatacgacgtg
cccaaggcagtcgggttcggaatcagtagcggtgaccacgccgaacgaatcgtccgaagc
ggtgctgacggtattatcgtcgggagcgcgctcgtcgatatcgtggccgcgggccatgag
gacggtgacgacccgggaacggtcgctgaccgcctcgaaacgctcgcccgcgaacttaaa
gaaggcgcactctcgggtgcttcgcaacgcccaccgcattcggaacgcacataa

DBGET integrated database retrieval system