KEGG   Haloferax mediterranei: HFX_0787Help
Entry
HFX_0787          CDS       T02129                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hme  Haloferax mediterranei
Pathway
hme00260  Glycine, serine and threonine metabolism
hme00750  Vitamin B6 metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01230  Biosynthesis of amino acids
Module
hme_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0787 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HFX_0787 (thrC)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HFX_0787 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AFK18510
UniProt: I3R2Q0
Position
744990..746159
Genome map
AA seq 389 aa AA seqDB search
MRTSDTFSGLVCTETGDEYDAAATGPSDADAPLDPTYDLDAVEWDAETLAERPFDTMWRY
RELLPFSDPVTANEGATPLVAATALGDETGVGTLLIKDEGRNPTGTFLDRGFSLALTAAR
EADAEVVAHASPGNGAQSAASYAGLIDVRSYGFVPSRTPFPNKAMVNVHGGQMKVVGGRY
PAALSALHEKLKSDWFTLQEFDNPYRHEGAKTIAYEVAERLDWSVPDWVVVPVATGELIY
GVYKGFRDLAELGLVDDVPRLVAAQSIGCAPIATAWEADNDDHEAWNHPDTIVGELEIPD
PAGGSLALRALRESDGLAVSVSDDDALESAVTAAQTAGVEVGPAGGVALAAIWDLADEFD
ADETVVAVNTESGTKNADILRSHLMGQGI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacttccgacacgttctcagggctggtgtgtacggaaaccggcgacgaatacgac
gccgccgcgaccgggccgagtgatgcggacgcgccgctcgaccccacgtacgacctcgac
gcagtcgagtgggacgccgagacgctcgcagagcgccccttcgatacgatgtggcgctac
cgcgaactactccccttttccgacccggtgacggcgaacgagggcgcgacgccgctcgtg
gcggccacggcgctcggtgacgaaacgggcgtcggcacactcctcatcaaagacgagggc
cgaaacccaaccggcacgttcctcgaccgtggcttctcgctcgcgctcaccgctgcgcgc
gaggccgacgccgaggtcgtcgcgcacgcttcgcccggcaacggcgcgcagtcggcggcg
tcctacgcgggtctcatcgacgttcgctcgtacgggttcgtcccatcgcggacgcccttc
ccgaacaaagcgatggtgaacgtccacggcggccagatgaaggtcgtcggcgggcgctat
cccgcggcgctctctgcacttcacgaaaagctcaaaagcgactggttcacgcttcaggag
ttcgacaatccgtaccgtcacgagggtgcgaaaaccatcgcctacgaggttgccgagcga
ctcgactggtcagtcccggactgggtggtcgtccccgtcgccaccggcgaactcatctac
ggcgtctacaagggcttccgcgaccttgccgagttgggtctcgtcgatgacgtccccaga
ctcgtggccgcccagtctatcggatgtgcacctatcgccaccgcgtgggaggccgacaac
gacgaccacgaagcgtggaaccaccccgacactatcgtcggcgaactggagattcccgac
cccgctggcgggtcgctcgcgctccgtgccctgcgcgaatcggacggcctcgctgtctcc
gtcagcgacgacgacgccctcgaatcggcggtcaccgccgcgcaaactgcgggcgtcgaa
gtcggtccggccggtggcgtcgccctcgccgccatctgggacctcgcggacgagttcgat
gcagacgagacggtcgtcgccgtcaacaccgaatccgggacgaaaaacgccgatatcctc
cgtagtcacctgatgggtcaaggaatctag

DBGET integrated database retrieval system