KEGG   Haloferax mediterranei: HFX_0787Help
Entry
HFX_0787          CDS       T02129                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFX_0787 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_0787 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HFX_0787 (thrC)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HFX_0787 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744990..746159
Genome map
AA seq 389 aa AA seqDB search
MRTSDTFSGLVCTETGDEYDAAATGPSDADAPLDPTYDLDAVEWDAETLAERPFDTMWRY
RELLPFSDPVTANEGATPLVAATALGDETGVGTLLIKDEGRNPTGTFLDRGFSLALTAAR
EADAEVVAHASPGNGAQSAASYAGLIDVRSYGFVPSRTPFPNKAMVNVHGGQMKVVGGRY
PAALSALHEKLKSDWFTLQEFDNPYRHEGAKTIAYEVAERLDWSVPDWVVVPVATGELIY
GVYKGFRDLAELGLVDDVPRLVAAQSIGCAPIATAWEADNDDHEAWNHPDTIVGELEIPD
PAGGSLALRALRESDGLAVSVSDDDALESAVTAAQTAGVEVGPAGGVALAAIWDLADEFD
ADETVVAVNTESGTKNADILRSHLMGQGI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacttccgacacgttctcagggctggtgtgtacggaaaccggcgacgaatacgac
gccgccgcgaccgggccgagtgatgcggacgcgccgctcgaccccacgtacgacctcgac
gcagtcgagtgggacgccgagacgctcgcagagcgccccttcgatacgatgtggcgctac
cgcgaactactccccttttccgacccggtgacggcgaacgagggcgcgacgccgctcgtg
gcggccacggcgctcggtgacgaaacgggcgtcggcacactcctcatcaaagacgagggc
cgaaacccaaccggcacgttcctcgaccgtggcttctcgctcgcgctcaccgctgcgcgc
gaggccgacgccgaggtcgtcgcgcacgcttcgcccggcaacggcgcgcagtcggcggcg
tcctacgcgggtctcatcgacgttcgctcgtacgggttcgtcccatcgcggacgcccttc
ccgaacaaagcgatggtgaacgtccacggcggccagatgaaggtcgtcggcgggcgctat
cccgcggcgctctctgcacttcacgaaaagctcaaaagcgactggttcacgcttcaggag
ttcgacaatccgtaccgtcacgagggtgcgaaaaccatcgcctacgaggttgccgagcga
ctcgactggtcagtcccggactgggtggtcgtccccgtcgccaccggcgaactcatctac
ggcgtctacaagggcttccgcgaccttgccgagttgggtctcgtcgatgacgtccccaga
ctcgtggccgcccagtctatcggatgtgcacctatcgccaccgcgtgggaggccgacaac
gacgaccacgaagcgtggaaccaccccgacactatcgtcggcgaactggagattcccgac
cccgctggcgggtcgctcgcgctccgtgccctgcgcgaatcggacggcctcgctgtctcc
gtcagcgacgacgacgccctcgaatcggcggtcaccgccgcgcaaactgcgggcgtcgaa
gtcggtccggccggtggcgtcgccctcgccgccatctgggacctcgcggacgagttcgat
gcagacgagacggtcgtcgccgtcaacaccgaatccgggacgaaaaacgccgatatcctc
cgtagtcacctgatgggtcaaggaatctag

DBGET integrated database retrieval system