KEGG   Haloferax mediterranei: HFX_0796Help
Entry
HFX_0796          CDS       T02129                                 

Gene name
frvX
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hme  Haloferax mediterranei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HFX_0796 (frvX)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     HFX_0796 (frvX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(753439..754485)
Genome map
AA seq 348 aa AA seqDB search
MDFDFDRLKQLTETSGVPGYEDRIRALVREDLEETTDRVRVDPMGNVVGTIEGKSDYEVA
VAAHMDEIGFMVRHINDDGFIQLDALGGWDPRVLKAQRVTVHTEDEDLTGVIGSVPPHTL
TEEQKKKDPKVKDAYVDVGLPAETVKETVSVGDLVTMEQTTVRMGDHITGKAIDDRVCLF
AMLEAARRIEDPDVTIHFAATVQEEVGLRGAQALGVDLNPDLALGLDTTVANDVPGFDPA
DFVTELGEGAGIKLKDSSAIANPKIHRRLRDVAETNEIDYQMELLPAGGTDTGGFQNTYG
AKPVGAISMPTRYLHTVTESVHEDDVVAYIDLLTAFLESETGEFDYTL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggactttgatttcgaccgactgaagcaactcaccgagaccagtggcgtcccgggctac
gaggaccgtatccgcgcgctcgtccgcgaggacctcgaagaaacgacggaccgcgttcgt
gtcgacccgatgggcaacgtcgtcggcaccatcgagggcaaaagtgactacgaggtcgcc
gtcgccgcccacatggacgaaatcggcttcatggtccgccacatcaacgacgacggcttc
atccaactcgacgcgctcggcggctgggacccccgcgtcctgaaggcccagcgcgtcact
gtccacactgaagacgaggaccttacgggcgttatcggctccgtcccgccgcacacgctc
accgaggagcagaagaagaaggacccgaaggtcaaagacgcgtacgtcgacgtcggtctg
cccgccgagacggtcaaagagaccgtctccgtcggcgacctcgtgacgatggaacagacg
accgtccgcatgggcgaccacatcacgggcaaggccatcgacgaccgcgtctgcttgttc
gctatgctcgaagccgcccggcgcatcgaggaccctgacgtaaccatccacttcgcagca
acggtgcaggaagaagtcggcctccgcggcgcacaagcactcggcgtcgacctcaacccc
gacctcgcactcggtctcgacacgaccgtcgcaaacgacgtgcccggcttcgacccggca
gacttcgtcaccgagctcggcgaaggtgccggtatcaaactgaaagactccagcgccatc
gccaatcccaaaatccaccgtcgcctgcgcgacgtggccgaaacgaacgaaatcgactac
cagatggagctgctccccgctggcggcacggacaccggtggcttccagaacacctacggc
gcaaagccggtcggtgccatctcgatgccgacgcgctacctccacaccgtcacggagagc
gtccacgaggacgacgtggtcgcctacatcgacctcctgacggcgttcttggagagcgag
acgggcgagttcgactacacgctctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system