KEGG   Haloferax mediterranei: HFX_0796Help
Entry
HFX_0796          CDS       T02129                                 

Gene name
frvX
Definition
(GenBank) endoglucanase (EC:3.2.1.4)
Organism
hme  Haloferax mediterranei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(753439..754485)
Genome map
AA seq 348 aa AA seqDB search
MDFDFDRLKQLTETSGVPGYEDRIRALVREDLEETTDRVRVDPMGNVVGTIEGKSDYEVA
VAAHMDEIGFMVRHINDDGFIQLDALGGWDPRVLKAQRVTVHTEDEDLTGVIGSVPPHTL
TEEQKKKDPKVKDAYVDVGLPAETVKETVSVGDLVTMEQTTVRMGDHITGKAIDDRVCLF
AMLEAARRIEDPDVTIHFAATVQEEVGLRGAQALGVDLNPDLALGLDTTVANDVPGFDPA
DFVTELGEGAGIKLKDSSAIANPKIHRRLRDVAETNEIDYQMELLPAGGTDTGGFQNTYG
AKPVGAISMPTRYLHTVTESVHEDDVVAYIDLLTAFLESETGEFDYTL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggactttgatttcgaccgactgaagcaactcaccgagaccagtggcgtcccgggctac
gaggaccgtatccgcgcgctcgtccgcgaggacctcgaagaaacgacggaccgcgttcgt
gtcgacccgatgggcaacgtcgtcggcaccatcgagggcaaaagtgactacgaggtcgcc
gtcgccgcccacatggacgaaatcggcttcatggtccgccacatcaacgacgacggcttc
atccaactcgacgcgctcggcggctgggacccccgcgtcctgaaggcccagcgcgtcact
gtccacactgaagacgaggaccttacgggcgttatcggctccgtcccgccgcacacgctc
accgaggagcagaagaagaaggacccgaaggtcaaagacgcgtacgtcgacgtcggtctg
cccgccgagacggtcaaagagaccgtctccgtcggcgacctcgtgacgatggaacagacg
accgtccgcatgggcgaccacatcacgggcaaggccatcgacgaccgcgtctgcttgttc
gctatgctcgaagccgcccggcgcatcgaggaccctgacgtaaccatccacttcgcagca
acggtgcaggaagaagtcggcctccgcggcgcacaagcactcggcgtcgacctcaacccc
gacctcgcactcggtctcgacacgaccgtcgcaaacgacgtgcccggcttcgacccggca
gacttcgtcaccgagctcggcgaaggtgccggtatcaaactgaaagactccagcgccatc
gccaatcccaaaatccaccgtcgcctgcgcgacgtggccgaaacgaacgaaatcgactac
cagatggagctgctccccgctggcggcacggacaccggtggcttccagaacacctacggc
gcaaagccggtcggtgccatctcgatgccgacgcgctacctccacaccgtcacggagagc
gtccacgaggacgacgtggtcgcctacatcgacctcctgacggcgttcttggagagcgag
acgggcgagttcgactacacgctctaa

DBGET integrated database retrieval system