KEGG   Haloferax mediterranei: HFX_0870Help
Entry
HFX_0870          CDS       T02129                                 

Gene name
acs
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_0870 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_0870 (acs)
   00620 Pyruvate metabolism
    HFX_0870 (acs)
   00640 Propanoate metabolism
    HFX_0870 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HFX_0870 (acs)
   00680 Methane metabolism
    HFX_0870 (acs)
Enzymes [BR:hme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HFX_0870 (acs)
Lipid biosynthesis proteins [BR:hme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HFX_0870 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
828809..830797
Genome map
AA seq 662 aa AA seqDB search
MADGDSELEARLVEQAEFEPTAEFVEQANVSDPSIYEEFEENWPECWERAAEMLDWDDDY
DEVLDDSNPPFYKWFTGGKLNVSYNCVDRHVENGEKNRVAIKWEGEHGDTRTYTYQDLYR
EVNEFAAALRDLGVEEDDVVTLYMPMVPELPIAMLACARIGAPHSVVFGGFSAEALATRM
NSADSRYLVTCDGYYRRGDALDHLDKANEGLDGVDHGVDATVVVDRLGDDGFGHDLKANQ
HDWDDLMSEHAGERIDPVERDAEDMLFLMYTSGTTGQPKGVKHTTGGYLAYAAWTSHAVL
DIKKEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDFPNRDRLWDIVEKYSVDI
FYTAPTAIRAFMKWGSRFPEQHDLSSLRLLGTVGEPINPRAWKWYYKHIGNEECPVVDTW
WQTETGGMMITTLPGIKKMKPGSAGPPLPGIDAKVVDTSGEQVDAGRAGYLTVDKPWPGM
LRTLYKNDERFVQEYWREYSDTDSNDPADWVYFPEDGAKIDQDEYITILGRVDDVINVSG
HRLGTMEIESAIVGVEGVAEAAVVGGDHEVKGEAVYAYVITEESQTEDDEMRERIITGVE
DAIGPIARPEQVVFTPELPKTRSGKIMRRLLEEIANGEELGDTTTLRNPEIVESIQQQVD
TE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcagatggtgacagtgaacttgaggcacggttggtggagcaagcggagttcgaaccc
actgcggagttcgtcgaacaggcgaacgtgtcggacccctcgatttacgaggagttcgag
gagaactggcccgagtgttgggaacgggccgccgagatgctggattgggatgacgactac
gacgaggtacttgatgactcgaatccaccgttctacaagtggtttaccggtggaaagctg
aacgtctcgtacaactgtgtcgaccgacacgtcgaaaatggcgagaaaaaccgggttgca
atcaagtgggagggggaacacggcgacacgcggacctacacgtatcaggacctctatcgc
gaggtaaacgagttcgcggccgcactccgggacctcggcgtcgaggaagacgacgtggtg
actctctatatgccgatggttcccgagctaccgattgcgatgctcgcgtgtgctcgtatc
ggcgcaccgcactcggtggtattcggtgggttctctgccgaggcgctcgcgacgcggatg
aactccgctgactcccggtatctcgtcacttgtgacggctactaccgccgcggcgacgca
ctcgaccacctcgacaaggcgaacgagggtctcgatggcgtcgaccacggcgtcgatgca
acagtggttgtcgaccgactgggagacgatgggttcggacacgacctgaaggcaaaccag
cacgactgggacgacctgatgagcgaacacgctggcgagcgtatcgaccccgtcgagcgc
gacgccgaagacatgctcttcttgatgtacacctcgggcacgaccggtcagcccaaaggc
gtcaaacacaccaccggcggctatctcgcctatgcggcgtggacctcacacgccgtctta
gacattaaaaaggaagacacctactggtgctctgcggacatcggctggattaccggccac
tcctacatcgtctatggaccgctggccctcggaacgacgactgtcatgtacgagggtacc
ccggacttccccaaccgcgaccgtctgtgggacatcgtcgaaaagtactcggtcgacatt
ttctacaccgcgccgacggcgattcgtgccttcatgaagtggggaagtaggttcccagaa
caacacgacctgtcgagtctccgcctcttggggacagtgggtgaacccatcaacccgcgt
gcgtggaagtggtactacaagcacatcggcaacgaggagtgccctgtcgtcgacacgtgg
tggcagactgagacgggcgggatgatgattacgaccctcccgggaatcaagaagatgaaa
ccggggtcagccgggccgccgctgccgggtatcgacgcgaaagtcgtcgatacgagtggg
gagcaggtcgatgctggccgagcgggctacctcacggtcgacaagccgtggccgggcatg
ctccggacgctctacaagaacgacgagcgattcgtccaggagtactggcgggagtactct
gataccgacagcaacgacccagccgactgggtgtacttcccagaggacggagcgaaaatc
gaccaggacgagtacatcaccatccttggccgcgtcgacgacgtaatcaacgtctccgga
caccgtctcgggacgatggaaatcgagtccgccatcgtcggtgtcgaaggcgtcgccgaa
gcggcggtcgtcggcggcgaccacgaggtaaaaggcgaggccgtctacgcctacgtcatc
acagaagagtcacagacggaagacgacgagatgcgcgaacgcatcatcacgggcgtcgaa
gacgcaattggcccaatcgcccgccccgaacaggtcgtgttcacgcccgaactgccgaag
acgcggtctgggaagattatgcgtcgactcctcgaagagattgcgaacggagaagaactc
ggtgatacaacgacgcttcggaaccccgaaatcgtcgaatcgattcagcaacaggtcgac
accgagtag

DBGET integrated database retrieval system