KEGG   Haloferax mediterranei: HFX_0962Help
Entry
HFX_0962          CDS       T02129                                 

Gene name
deoA
Definition
thymidine phosphorylase/AMP phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
hme  Haloferax mediterranei
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HFX_0962 (deoA)
Enzymes [BR:hme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     HFX_0962 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
915730..917208
Genome map
AA seq 492 aa AA seqDB search
MKLIAESIDIGTRSPTVLLNEADAAELGVHALERIQLQRDGRTTIGIVELTDELISEGTL
GVTRRLGHIDGPVEVSVAPQPNSVYYIRKKLDDIELEHRELERIVRDIYEERLADIELGA
YVSAIYTNGLSMEETMHLTSCMANIGETISWNDSIIADKHSIGGVAGNRVTPILVSIIAA
AGVKIPKTSSRAVTSASGTADTMEVFCDVEFSIEEIREIVKETGGCLVWGGAVNLSPVDD
QIIRAETPLSLDPKGQLIASVLSKKKSAGSTHAVIDIPYGEGAKVESLAEARELAEDFNR
VSEHLGMTIECAITSGSAPVGRGIGPVLEAREVLATLDGEGPNDLRVKAIRLADLLFESV
GVDADATEILDSGAAQETFREILAAQNGDPDVAVSDLSLGRHTHIVRADRDGVVTHINNR
LVNEVGRRAGAPKDHGAGLELHRCVGEETESGESLVTVYAESSDKLADAVDLLERIEMVR
VRHPDEALVDRV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatcgctgaatctatcgacatcggaactcgttcgccgacagtccttctgaac
gaggctgatgcggcggaactgggggtgcatgcactcgaacgcatccaactgcaacgcgac
ggtcggacgacgattggaatcgtggagttaactgacgaactcatctctgagggcacgctc
ggcgtcacacgtcgcctcggacacatcgacgggccagtcgaggtgtcggtcgcaccgcaa
ccgaactcggtgtactacatccgcaagaaactcgacgacatcgaactcgaacaccgtgaa
ctcgagcgtatcgtccgggatatctacgaggagcgactcgccgatatcgaactcggtgcg
tacgtctccgccatctacacgaacgggctttcgatggaagagacgatgcacctcacatcg
tgtatggcgaatatcggtgagaccatctcgtggaacgactccatcatcgccgacaagcac
tctatcggcggtgttgcggggaatcgcgtcacgccgatactcgtctccatcatcgccgct
gcgggtgtgaagattcccaaaacctcgtcccgggcagtcacctcggcatccggaaccgca
gatacgatggaagtcttctgtgacgtggagttctccatcgaagagattcgggaaatcgtc
aaagagactggtggctgtctcgtctggggcggcgcggtgaatctctctccggttgacgac
caaatcatccgggctgagaccccgctttctctcgacccgaagggacaactcatcgcctcc
gtgctctcgaaaaagaagagcgccgggtcgacccacgcggttatcgatatcccctacggc
gagggggcaaaggtcgaaagcctcgccgaggcgcgcgagctcgccgaggacttcaaccgc
gtgagcgagcacctcggaatgactatcgagtgcgccattacgagtggctccgccccggtc
ggcagaggaatcggcccggtcctcgaagcgcgagaagtcctcgccacgctcgacggagag
ggaccgaacgacttacgggtaaaagcgattcggctcgcagacctgttgttcgaatccgtc
ggtgtcgacgctgacgccaccgagatactcgattcgggggcggcacaggagacattccgc
gaaatactcgccgcacagaacggtgacccggacgtggcggtatcagacctttcgctcggt
cgccacacccacattgtccgcgccgaccgagacggcgttgtcacgcacatcaacaatcgg
ttggtcaacgaagtcggcagacgagcgggcgcgccgaaagaccacggagcgggactcgaa
ctccatcgctgtgtcggcgaggagaccgaaagcggtgagtcgctcgtcaccgtctacgcg
gagtcgtccgacaaactcgccgatgcggtcgacctgttggaacgcatcgagatggttcgt
gttcgacaccccgacgaggcgctcgtcgatagagtgtga

DBGET integrated database retrieval system