KEGG   Haloferax mediterranei: HFX_1049Help
Entry
HFX_1049          CDS       T02129                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hme  Haloferax mediterranei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HFX_1049 (asnB)
Enzymes [BR:hme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HFX_1049 (asnB)
Peptidases [BR:hme01002]
 Cysteine Peptidases
  Family C44
   HFX_1049 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002865..1003956
Genome map
AA seq 363 aa AA seqDB search
MRGADSSLARRALDGRDPLPGTAGFAGQVDSRLVRDVLGRQPLFSERDDPETWSFDHRDL
SDPVAVPPGHARHMTGESAGRDESVWELPDPPVATDREDALARVRNAVSESVRSVDDDGL
AVAFSGGVDSAVVAAGVPDAPCYVAGFEGSHDIAAARDAADAMGRDLRVVELSHDALERA
VPEIVDALGRTNPMDVQIVLPLYLLAEQVAADGYDRLAVGQGADELFGGYAKVAKAPDDP
RVEAETVRGAARELIHTLPDQLERDVLVLRAAGVEPVAPLLHDRVVDAALPLPGELLVDG
DRRKVALREAAKDSIPESVAEANKKAVQYGTYASRELDRLARQAGFKRRIDNHVEKYVRS
LLE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgcggactcctctctcgctcggcgcgcgctcgacggccgcgacccgctcccc
ggaaccgcggggttcgcgggccaagtcgatagtcgtctcgtccgcgacgtgctcggccgc
caaccgctcttttccgaacgtgacgaccccgagacgtggtcgttcgaccaccgcgacctc
tccgacccggttgccgtcccgccgggccacgcccgtcacatgactggtgagtccgccggt
cgcgacgaatccgtctgggaacttcccgacccaccggttgccaccgaccgcgaggatgcc
ctcgcccgcgtccgcaacgccgtttccgagtcggttcgctcggttgacgacgacggactc
gccgtcgccttctctggcggcgtcgactccgcggtcgtcgctgctggcgttccggacgcc
ccgtgttacgtcgccgggttcgaaggctcacacgacatcgccgccgcccgcgacgccgcc
gatgcgatggggagagacctccgcgtcgtcgaactctcccacgacgcgctcgaacgcgcc
gtcccggaaatcgtcgatgcactcgggcggacgaatccgatggacgtgcaaatcgtcttg
ccgctgtatctgctcgccgagcaggtcgcagccgacggctacgaccgcctcgcggtcgga
cagggcgcggacgagctcttcggcggttacgccaaggtcgccaaggcccccgacgacccc
cgcgtcgaagccgagacggttcggggggccgcccgagaactgattcacacgctccccgac
caactcgaacgcgacgtgctcgtacttcgcgcggcgggcgtcgaaccggttgctccgctg
ctccacgaccgagttgtggacgccgcgctcccgcttccgggtgagttactcgtggacggc
gaccggcggaaagtcgccctccgcgaagccgcaaaggacagtattccggagtcagtcgcc
gaggcgaacaaaaaggcggtgcagtacggcacgtacgcctccagagaactcgaccgactc
gcccggcaagcgggattcaaacgccggatagacaaccacgtcgaaaaatacgtgcggtcg
ctgttagagtag

DBGET integrated database retrieval system