KEGG   Haloferax mediterranei: HFX_1095Help
Entry
HFX_1095          CDS       T02129                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hme  Haloferax mediterranei
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HFX_1095 (folP)
Enzymes [BR:hme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HFX_1095 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046471..1048921
Genome map
AA seq 816 aa AA seqDB search
MEYHEAVNFLFDLRRFQVKPGTESIQRLLSHLGDPHEGVSFVQVAGSNGKGSTARMLDST
LREAGQSVGLYTSPHFDNVRERVRVDGRKIPESALSAFVAEAKPYLVERAADGEPLTFFE
TVTALAIWYFDQADVDVAVLEVGMGGELDATSAVDPVASAVTNVSLEHTAVLGDTIEEIA
RTKAAVAPADNPLVTGAAGDALDVIREEVGDVLTVGGADADTDVRTAYGGRVNHQEAAVT
VETDDETLDLRIPLLGAYQARNAGIAVALSRQVRPDISDDEIHRGLRNAHWPGRFEVMGT
DPMVVLDGAHNPDACAQVATVLDEFEYDDLHLVYGAMHDKDHGEMVEALPDVASVVTCHA
DISRAEDPEILASVFERIDVPEVETGDVVASALERARERADPDDCVLVVGSLYVVAEART
TWTRAIIPKTHRTLDDARETLERANVADEGSRDERAAKAVHQTVHTRVQRRQARHLREEL
FSIGGDCAVSGHESGGELVDVVLMGTLDQFDRLTENLRDRPYALPELADEIEASLGRDPS
AETHGYPWEDGPSVMGILNVTPDSFHDGGEFYDIEDAVEQAEAMVEAGVGIIDVGGESTR
PGAEEVPVDEEIRRVTPVIEALSDLDALVSVDTRKAAVAEAALDAGADILNDVTGLEDPE
MRFLAAERDVPVIVMHSIDAPVIPDKDIDYDDVVEDVIDELTERVLLAEKAGIPRRNIIV
DPGLGFGKSKAENFELLGRVDEFRALGCPVLIGHSHKSMFSLVGEKTGDNLAATIAGTAI
AADRGADIIRVHDVPENVAAVNVALASQDSSRFTDE
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggagtaccacgaggcggtgaacttccttttcgacctccggcgattccaggtcaagccg
gggaccgagtcgattcagcggttgctctctcacctcggcgacccacacgagggagtctcg
ttcgtgcaggtcgcagggtcaaacggaaaaggaagcaccgcccggatgctcgactcgacg
ctccgcgaagcgggacagagcgtcgggttgtacacctcgccgcacttcgacaacgtgcgc
gagcgcgtccgcgtcgacgggcggaagattcccgaatccgcgctgtcggcgttcgtggcc
gaagcgaaaccgtatcttgtcgagcgtgccgccgacggcgaaccgctcacgttcttcgaa
accgtgaccgccctcgcaatctggtacttcgaccaggccgacgtcgacgtggcggtcctc
gaagtcgggatgggtggcgaactcgatgcgacgagcgccgtcgaccccgtcgccagcgcc
gtcacgaacgtctcgctcgaacacacggcggtcctcggcgataccatcgaagagattgcc
cggacgaaggctgccgtcgcgcccgcagacaacccactcgtgacgggtgctgcgggcgac
gcactcgatgtcatccgcgaggaggtcggcgacgtactgacggtcggcggcgcggacgcc
gataccgacgttcgaaccgcgtacggcggtcgcgtgaaccaccaagaggccgccgtcacc
gtcgaaaccgacgacgagacgctcgaccttcgaatcccgcttttaggtgcgtatcaggct
cgaaacgccggtatcgcagtcgcgctctcccgacaggtccggccagatatttccgacgac
gagattcaccgcggccttcgaaacgcgcactggccgggtcgcttcgaagtcatgggaacc
gacccgatggtcgtcttagacggggcacacaaccccgacgcctgcgcacaggtcgctacc
gtcctcgacgagttcgagtacgacgacctgcatctcgtctacggtgcgatgcacgacaag
gaccacggtgagatggtcgaagcgctgcccgacgtcgcctccgtcgtcacctgtcacgcg
gacatctcgcgggccgaagaccccgagattcttgcatcggtgttcgaacgaatcgacgtt
ccggaagtcgagacgggtgacgtggttgcatcggcgctggagcgcgcacgagaacgcgcc
gacccggacgactgcgtgctcgtcgtcgggtcgttgtacgtcgtcgccgaggcgcgaacg
acgtggacacgagcgataattccgaagacgcaccgtactctcgatgacgctcgcgagacg
ctcgaacgggccaacgtggcagacgaagggagtcgggacgagcgagcagcgaaggcggtt
catcagacggttcacacgcgcgtccagcgacgacaggccagacacctcagagaagaactg
ttctctatcggcggcgactgcgccgtttccggccacgagtccggcggcgaactcgtcgac
gtggtgttgatggggacgctcgaccagttcgaccgcttgacggaaaatctccgagaccgt
ccctacgcgctcccggaactcgccgacgagatcgaagcgagtctcggacgcgacccctcc
gccgagactcacggctacccgtgggaagacggtccatccgtcatgggcatcctcaacgtc
acgccggacagtttccacgacggcggcgagttctacgacatcgaagacgccgtcgaacag
gcggaagcgatggtcgaagccggtgtcggcattatcgacgtcggtggtgagagcacccgt
cccggtgccgaagaagtcccagtagacgaagagattcgccgagttacgcccgtcatcgag
gcactttcggacctcgacgcactcgtctccgtggacacccggaaagcggcggttgctgag
gccgcactggacgcaggggccgatatcctcaacgacgtgaccggcctcgaagaccccgaa
atgcggttcctcgcggccgagcgcgacgtcccggttatcgtgatgcacagcatcgacgcg
ccggtgattccggacaaggacatcgactacgacgacgtggtcgaagacgtaatcgacgaa
ctcacagagcgcgtcctgctcgccgaaaaggcgggaatcccgcgtcgaaacatcatcgtc
gaccccggtctcggattcgggaaatcgaaggccgagaacttcgaactcctcggacgcgtc
gacgagttccgtgcgctcgggtgtcccgttctcatcggccactctcacaagtcgatgttc
tcactcgtcggcgagaaaaccggggacaacctcgcggcaaccatcgcgggaacggctatc
gctgcggaccgcggcgctgacatcattcgcgtccacgacgtaccggagaacgtcgcggcc
gtgaacgtcgcgctcgcttcgcaggactcgagtcggtttaccgacgagtag

DBGET integrated database retrieval system