KEGG   Haloferax mediterranei: HFX_1233Help
Entry
HFX_1233          CDS       T02129                                 

Gene name
cheB
Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain / protein-glutamate methylesterase, two-component system, chemotaxis family, response regulator CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hme  Haloferax mediterranei
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:hme02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:hme02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1169802..1170911)
Genome map
AA seq 369 aa AA seqDB search
MGAMSSASAAEPTRAVVVDDSRFMRTLIRTLLEDADVDVIAEASNGREAITVVDEHRPDV
VTMDIEMPEMNGLDAVEAIMDECPTPILMLSAHAEEDADVTFDALDRGAVDFVTKPGGEV
TSEMPRVKRELVEKIQSAAAVDLSATRRTSRPPKTETKQQAATASPSSPSVESESLPTEG
TTLVIGASTGGPNVVERVLAALPKEAGLRVLVVQHMPAGFTERFAARLDARCDYEVQEAD
DGERIGPGQIRIAPGGSHLLVTRDRAGQLKLELSDDEPLHGVKPAIDLTMASAAETVDTP
LAGVLLTGMGRDGVEGMTQISRAGGHTVAQDEETSAIFGMPKRAIEAGCVDTIAPDGRIA
EETLRGLTT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggggcgatgagttccgcttccgcagcagaaccgacgcgcgcagtcgtcgtcgacgac
tcgcggttcatgcggacactcattcgcacactcctcgaagacgccgacgtcgacgttatc
gccgaagcgagcaacggacgtgaggcgattacagtggtcgacgaacatcgaccagacgtc
gtgacgatggacatcgagatgcccgaaatgaacggtctcgacgcggtcgaggccatcatg
gacgagtgtccgacgcccatcctcatgctctcggcgcacgccgaggaggacgcggacgtg
acattcgacgcactcgacagaggtgcggtcgacttcgtgaccaagcccggtggcgaagtc
acctccgagatgcctcgcgtgaagcgcgaactggtcgagaagattcagtccgctgcggcg
gtggacctctctgcgacccgacgaacgtctcgaccgccgaaaacggagacgaaacaacaa
gcagccaccgcgtcaccgtcgtcgccctcggtcgaatccgagtcgctcccgacggaaggg
acgacactcgttatcggcgcgtcgacgggcggcccgaacgtggtcgagcgcgtcctcgcg
gcgctcccgaaggaggctggtctccgtgtactcgtcgtccagcacatgccggcgggcttc
acagagcgattcgcagcgcgcctcgacgcccgctgtgactacgaggttcaagaggcagac
gacggagaacgcatcggtcccggacagattcgcatcgcaccgggtgggtcacacctcctc
gtcacgcgcgaccgcgctggacaactcaaactcgaactctccgacgacgaaccgctccac
ggcgtcaaaccggctatcgacctcacgatggcctccgccgccgagacggtcgatacaccc
ctcgcgggcgtgctcctgaccggaatgggtcgtgacggcgtcgagggaatgacccaaatc
agtcgagcaggtggccacacagtcgcacaagacgaagaaacgtctgcaatcttcgggatg
ccgaagcgcgccatcgaggccgggtgtgtcgacaccatcgcacctgacggacgcatcgcc
gaagaaacactccgcgggcttactacctga

DBGET integrated database retrieval system