KEGG   Haloferax mediterranei: HFX_1233Help
Entry
HFX_1233          CDS       T02129                                 

Gene name
cheB
Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain / protein-glutamate methylesterase, two-component system, chemotaxis family, response regulator CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hme  Haloferax mediterranei
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hme00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HFX_1233 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    HFX_1233 (cheB)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     HFX_1233 (cheB)
Two-component system [BR:hme02022]
 CheA family
  CheA-CheYBV
   HFX_1233 (cheB)
Bacterial motility proteins [BR:hme02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    HFX_1233 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1169802..1170911)
Genome map
AA seq 369 aa AA seqDB search
MGAMSSASAAEPTRAVVVDDSRFMRTLIRTLLEDADVDVIAEASNGREAITVVDEHRPDV
VTMDIEMPEMNGLDAVEAIMDECPTPILMLSAHAEEDADVTFDALDRGAVDFVTKPGGEV
TSEMPRVKRELVEKIQSAAAVDLSATRRTSRPPKTETKQQAATASPSSPSVESESLPTEG
TTLVIGASTGGPNVVERVLAALPKEAGLRVLVVQHMPAGFTERFAARLDARCDYEVQEAD
DGERIGPGQIRIAPGGSHLLVTRDRAGQLKLELSDDEPLHGVKPAIDLTMASAAETVDTP
LAGVLLTGMGRDGVEGMTQISRAGGHTVAQDEETSAIFGMPKRAIEAGCVDTIAPDGRIA
EETLRGLTT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgggggcgatgagttccgcttccgcagcagaaccgacgcgcgcagtcgtcgtcgacgac
tcgcggttcatgcggacactcattcgcacactcctcgaagacgccgacgtcgacgttatc
gccgaagcgagcaacggacgtgaggcgattacagtggtcgacgaacatcgaccagacgtc
gtgacgatggacatcgagatgcccgaaatgaacggtctcgacgcggtcgaggccatcatg
gacgagtgtccgacgcccatcctcatgctctcggcgcacgccgaggaggacgcggacgtg
acattcgacgcactcgacagaggtgcggtcgacttcgtgaccaagcccggtggcgaagtc
acctccgagatgcctcgcgtgaagcgcgaactggtcgagaagattcagtccgctgcggcg
gtggacctctctgcgacccgacgaacgtctcgaccgccgaaaacggagacgaaacaacaa
gcagccaccgcgtcaccgtcgtcgccctcggtcgaatccgagtcgctcccgacggaaggg
acgacactcgttatcggcgcgtcgacgggcggcccgaacgtggtcgagcgcgtcctcgcg
gcgctcccgaaggaggctggtctccgtgtactcgtcgtccagcacatgccggcgggcttc
acagagcgattcgcagcgcgcctcgacgcccgctgtgactacgaggttcaagaggcagac
gacggagaacgcatcggtcccggacagattcgcatcgcaccgggtgggtcacacctcctc
gtcacgcgcgaccgcgctggacaactcaaactcgaactctccgacgacgaaccgctccac
ggcgtcaaaccggctatcgacctcacgatggcctccgccgccgagacggtcgatacaccc
ctcgcgggcgtgctcctgaccggaatgggtcgtgacggcgtcgagggaatgacccaaatc
agtcgagcaggtggccacacagtcgcacaagacgaagaaacgtctgcaatcttcgggatg
ccgaagcgcgccatcgaggccgggtgtgtcgacaccatcgcacctgacggacgcatcgcc
gaagaaacactccgcgggcttactacctga

DBGET integrated database retrieval system