KEGG   Haloferax mediterranei: HFX_1365Help
Entry
HFX_1365          CDS       T02129                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM) (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_1365 (tpiA)
   01230 Biosynthesis of amino acids
    HFX_1365 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_1365 (tpiA)
   00051 Fructose and mannose metabolism
    HFX_1365 (tpiA)
   00562 Inositol phosphate metabolism
    HFX_1365 (tpiA)
Enzymes [BR:hme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HFX_1365 (tpiA)
Exosome [BR:hme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HFX_1365 (tpiA)
  Exosomal proteins of bladder cancer cells
   HFX_1365 (tpiA)
  Exosomal proteins of melanoma cells
   HFX_1365 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1284725..1285369
Genome map
AA seq 214 aa AA seqDB search
MFILVNLKAYPCDPIEVATAARDVAEESGVRIAVSPQAADISRVADTGVETWAQHVDPNG
HGSHTGSTLAEAVAEAGAEGTLINHSEKRLKLADIDGSVQAAERAGLETCVCANNPAQIG
AVSALGPDSVAVEPPELIGGDVSVATADPGIVTDAVDAAANVDDAVDVYCGAGISTGDDV
VTAEELGASGILLASGVAKADDPRAALEDLVSGL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgttcatcctagtcaatctcaaggcgtacccgtgtgaccccatcgaagtagcgactgct
gcacgcgatgtcgccgaagaatccggtgttcgaatcgcggtctcgccgcaggcggccgat
atctcccgcgtcgccgacaccggcgtcgaaacgtgggcacagcacgtcgacccgaacggt
cacggcagtcacaccggcagcaccctcgccgaagcggtcgcagaggccggtgccgagggg
acgctcatcaaccactccgaaaagcgtctgaaactcgccgacatcgacggctccgtacag
gccgcagagcgcgccggactggagacgtgcgtctgtgcgaacaatcccgcccagattggc
gcggtctccgcactcggcccggactcggtcgcagtcgaaccgccggaactcatcggcggc
gacgtctccgtcgcaaccgctgaccccggcatcgtcaccgacgccgtcgacgccgcggcc
aacgttgacgacgctgttgacgtgtactgcggtgccggtatctcgaccggtgacgacgtg
gtgactgctgaagaactcggcgcgtccggtatcctcctcgcatccggtgtcgccaaggcg
gacgacccgcgtgcggccctcgaagacctcgtctccgggctgtaa

DBGET integrated database retrieval system