KEGG   Haloferax mediterranei: HFX_1519Help
Entry
HFX_1519          CDS       T02129                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hme  Haloferax mediterranei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hme00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hme00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1433697..1434614
Genome map
AA seq 305 aa AA seqDB search
MRQDHLISAAHLSREDIEAVLDRAAEIDDDTAAFRQRHAGKVLGLCFFEPSTRTRMSFDT
AMKRLGGQTVDMGPVESSSVKKGETLADTVRVVEGYADALVLRHPSEGAATMAAEFVDVP
LVNAGDGAGQHPSQTLLDLYTIRENAGLDDLTIGIMGDLKYGRTVHSLAEALTNFDASQH
FISPESLRLPRNVRYDLHASGAQVKEHTELDEVLPELDVLYVTRIQRERFPDENEYRKVA
GQYQIDAETLKAASDDLTVMHPLPRVDEISPDIDDTDHATYFEQAHNGIPVRMALLDILL
SQADD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggaccacctcatctccgcggcacacctctcgcgggaggacatcgaggcggtg
ctcgaccgcgcggccgaaatcgacgacgacacggctgcgttccggcaacgacacgccgga
aaggttcttgggctctgtttcttcgagccgagcacgcgaactcgaatgagcttcgacacc
gcgatgaaacgccttggcggccagacggtcgacatgggaccggtcgagtcgtcgtcagtc
aagaaaggcgagacgctcgccgacacggtccgcgtggtcgaaggctacgcggacgccctc
gtgcttcgccacccgagtgagggcgcggctacgatggccgccgagttcgtcgacgtaccc
ctcgtcaacgccggtgacggcgcgggccagcacccgagccagaccctcctcgacctctac
accattcgggagaacgccggactcgacgacctcaccatcggcatcatgggtgacctgaaa
tacgggcggacggttcactccctcgctgaggcgctgacgaacttcgacgccagccagcac
ttcatcagccccgagagtctccgactcccccgaaacgttcgatacgacctccacgcctcg
ggcgcgcaggtcaaggaacacaccgaactcgacgaggtgctccccgaactcgacgtgctc
tacgtgacgcgtatccagcgcgagcgcttccccgacgaaaacgagtaccgaaaggtcgcg
ggacagtaccaaatcgatgctgagacgttgaaggccgcttccgacgacctcaccgtcatg
cacccgcttccccgcgtggacgagatttcgcccgacatcgacgataccgaccacgcgacg
tacttcgaacaggctcacaacggcatcccggttcggatggcgcttctggacatcctcctc
tcacaagccgatgactga

DBGET integrated database retrieval system