KEGG   Haloferax mediterranei: HFX_1602Help
Entry
HFX_1602          CDS       T02129                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hme  Haloferax mediterranei
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HFX_1602 (glpK)
Enzymes [BR:hme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HFX_1602 (glpK)
Exosome [BR:hme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HFX_1602 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522481..1524019
Genome map
AA seq 512 aa AA seqDB search
MSGETYVGAIDQGTTGTRFMVFDHDGKVVANAYEKHEQIYPEPGWVEHDANEIWENTKTV
INEALNDALLDPEQLEAIGITNQRETTIVWDRETGQPIHNAIVWQDRRTTDRIETLEADG
KTDEVRAKTGLEPDAYFSATKAEWILDNSDPIKLQRSRPEDIRDRAAEGELAFGTIDTWL
IYKLTGNHITDVTNASRTMLFNIHDMEWDDELLDEFNVPREILPEVRPSSDDDHYGETDA
SGFLGAEVPVAGALGDQQAALFGQTCFDAGDAKNTYGTGSFMLMNTGEEAVMSEHGLLTT
VGFQRSGEPVQYALEGSIFITGAAIEWLEDMTLIENASESEKLARSVDSTDGVYFVPAFA
GLGAPHWDQRARGTIVGMTRGTRREHIVRATLESIAFQTRDVAEAMESDSGIDLSSLRVD
GGAVKNNFLCQLQSNILDTEIVRPQVDETTALGAAYAAGLAVGYWETMEELRANWQVDRE
FGPSDPQNVEHRYGRWKEAVDRSLDWARDTEE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagaaacatacgttggtgccatcgaccaaggtaccacaggcacgcgcttcatg
gtgttcgaccacgacggaaaggtggtcgccaacgcctacgagaagcacgaacagatttac
cccgaacccggttgggtcgaacacgacgcaaacgagatttgggagaatacgaagacggtc
atcaacgaggcgctcaacgacgcgcttctcgacccggaacaactcgaagcaatcggtatc
acgaaccagcgcgagacgaccatcgtctgggaccgtgagactggacagccgattcacaac
gccatcgtctggcaggaccgccgcacgacggaccgaatcgagacgctcgaagcggacggt
aagacggacgaagtgcgcgcgaagacgggactcgaacccgacgcatacttctctgcgacg
aaggccgaatggatactcgataactccgaccccatcaagcttcagcgctcgcgacccgaa
gatatccgcgaccgcgccgcggaaggcgaactcgccttcggtaccatcgacacgtggctc
atctacaagctgacgggtaaccacatcacggacgttaccaacgcgtcgcggaccatgttg
ttcaacatccacgacatggagtgggacgacgaactcctcgacgagttcaacgtcccccgc
gagattctccccgaagttcgaccgtcgtctgacgacgaccactacggcgagaccgacgca
agcggcttcctcggtgccgaagtgcccgtcgcgggtgcgctcggcgaccagcaggccgcg
ctgttcggccagacctgtttcgacgctggcgacgccaagaacacctacggtaccggttcg
ttcatgctcatgaacaccggcgaagaggcagtcatgtccgaacacggcctgcttacgacc
gtcggcttccagcgttccggcgaacccgtccagtacgctctcgaagggtcgattttcatc
accggcgcggctatcgaatggctcgaagacatgacgctcatcgagaacgcctccgagtcc
gaaaagctcgctcggtcggtcgactcgactgacggcgtctacttcgttcccgctttcgcc
ggtctcggtgcgccgcactgggaccagcgtgcccgtgggaccatcgtcggcatgactcgc
ggcacccgccgcgaacacatcgttcgtgcgacgctcgaatccatcgcgttccagacgcgc
gacgtggccgaagccatggagtccgacagcggtatcgacctctccagcctccgcgtggac
ggcggagcggtcaagaacaacttcctctgtcagctccagtcgaatattctcgacaccgaa
atcgtccgtccgcaagtcgacgagacgacagcactcggtgctgcctatgccgcgggtctc
gccgtcggctactgggagacgatggaagaactccgcgcgaactggcaggtcgaccgcgag
ttcggtccctcggacccgcagaacgtcgaacaccgctacggccgctggaaagaggcagtc
gaccgctcgctggattgggcacgggacacggaggagtaa

DBGET integrated database retrieval system