KEGG   Haloferax mediterranei: HFX_1634Help
Entry
HFX_1634          CDS       T02129                                 

Gene name
speB
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hme  Haloferax mediterranei
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFX_1634 (speB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HFX_1634 (speB)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HFX_1634 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1559526..1560425)
Genome map
AA seq 299 aa AA seqDB search
MAKSVRIIGAPTDYGANRRGVDMGPSAIRYAGLTDQLESADVSPEDAGDLTVPHHAIHDA
DAGGDNAKHINEVEEVCTALADAVANALDDGVTPLALGGDHSIAIGSMVGSARDADIGVV
WFDAHGDFNTPETSPSGNVHGMPLAAALGIGDFEGVEWANAPSLKEENVAIVGLRDVDEN
ETTAIHDSDVTAYTMSDIDERGITEVTQDALDVATSGTDGVHVSLDLDWLDPREAPGVGT
PVRGGATYREAHAAMELVAESGAMRSLELVEVNPILDEHNETATLATELAASAFGKRIL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatctgtccgaattatcggcgcaccaacggattacggtgcaaaccgacgtggc
gtggatatgggcccttccgcgattcgatacgcaggacttacggaccaactcgaatccgct
gacgtctcaccggaagacgccggcgacctcacggtcccacaccacgcgattcacgacgcc
gatgctggtggagataacgccaagcacatcaacgaagtcgaagaggtctgtacggcgctc
gctgacgccgtcgcgaacgcactcgacgatggcgtaacgccactcgcccttggcggtgac
cactcaattgcaatcgggtcgatggtcggaagcgcacgtgacgccgacatcggcgtcgtc
tggttcgacgcccacggcgacttcaacacgcccgaaacctcgccgtcggggaacgtccac
ggcatgccccttgccgccgcgctcggcatcggtgacttcgagggcgtcgagtgggctaac
gcaccgagcctgaaagaagaaaacgtcgctatcgtcggcctccgcgacgtcgacgaaaac
gagacgacggcgattcacgacagtgacgtgaccgcctacacgatgtctgacatcgacgag
cgcggcatcaccgaagtgactcaggacgcgctcgatgtcgccacgagcggaaccgacggt
gtccacgtcagtctcgacctcgactggctcgaccccagagaggcacctggcgtcgggacg
cccgtccgcggtggagccacgtaccgcgaggcccacgcggcgatggaactcgtcgccgag
tcgggggcgatgcgttcgctcgaactcgtcgaagtcaaccccatcctcgacgagcacaac
gagacggccacgctcgcgaccgaactcgccgccagtgccttcgggaagcgtatcctctga

DBGET integrated database retrieval system