KEGG   Haloferax mediterranei: HFX_1643Help
Entry
HFX_1643          CDS       T02129                                 

Gene name
acs
Definition
acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hme01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hme00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hme00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hme00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:hme00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566531..1568525
Genome map
AA seq 664 aa AA seqDB search
MDVPDTDTVVHEPDSAFVEDANVTRFMREHDIEDYDELIERTTTEVPGVSASGVDWFWDE
LVDYLDIEFYDDYDEVRDNSDGPQFTRWYPGGELNIAHNVLDRHAAVDSPNRNRVACIWE
GEDGEVVQRTFHDLYQEANRVANVLESYGVGTGDTVGLYMPMVPEVISILYGCFKVGATA
VPIFSGFGVDATATRLEDPECSVLFTADGFYRRGSEVRLKPTADEAIEEAGCVEHVVVYQ
RFEDSNEDVPWTDGRDELWANTVDEADSEYETKHLPSDAESMLLYSSGTTGKPKGIVHTH
AGVQAQTAKEIHFGFDQKPEDRFFWVSDIGWMMGPWTLIGNHTFAGTIFMYEGAPDHPEP
DRFWDMIERHRITTFGISPTAIRALRKYGDEAVDKHDLSSLRLLGSTGEPWDPESWMWFY
EHVGGGEAPIINISGGTEICGCFLMPMPTQPLKPCSLGGPGLGMDIDIVDSAGESIADTH
ERGFLVARDSCPAMTKSLWSGDERYLDTYWSSWENLWDHGDWAQKDEDGFWFLHGRADDA
LNVAGRKVGPAEVEGALIEHDAVNQAAAVGADDDTTGTAVVAYVVLEDDVEENDDLREKL
RGVVGEELGKPFRPREILFVDEFPKTQSGKIIRRAIASIYAGEELGDMSSIENPEALEKL
EQAS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacccgacaccgataccgtggtgcacgaaccggactcggcgttcgtcgaagat
gccaacgtgactcgattcatgcgggaacacgacatcgaggactacgacgaactcatcgaa
cggacgacgaccgaggtgccgggtgtgagcgcctccggcgtcgactggttttgggacgaa
ctcgtcgactatctcgatatcgagttctacgatgactacgacgaagtacgtgacaattcg
gacggcccgcagttcactcgctggtaccccggcggcgaactcaacatcgcccacaacgtg
ctggaccgacacgccgccgtcgactccccgaaccgaaaccgcgtcgcctgtatctgggag
ggtgaagacggcgaggtcgtccagcggaccttccacgacctgtatcaggaggcgaaccgc
gtcgccaacgtcctcgaatcctacggcgtcggcaccggcgacaccgtcggtctctacatg
ccgatggtccccgaagtcatctccatcctctacggctgtttcaaagtcggcgcaaccgcc
gtccccatcttctccgggttcggcgtcgacgccaccgcgacccgtctcgaagaccccgag
tgctcggtgttgttcaccgccgacggcttctaccgccgcgggtcggaagtccgactgaag
ccgacagcagacgaggccatcgaagaagccggatgcgtcgaacacgtcgtcgtctaccag
cggttcgaggatagtaacgaggacgtcccgtggaccgacggccgcgacgagttgtgggcg
aacaccgtcgacgaggccgactccgaatacgagacgaaacacctcccctcggacgcagag
tcgatgctgctctactcgtcggggacgacggggaagccgaaaggaatcgtccacacccac
gccggcgtgcaggctcagacggccaaggagattcacttcggcttcgaccagaagcccgaa
gaccgcttcttctgggtctccgacatcggctggatgatgggaccgtggacgctcatcggg
aaccacaccttcgctggaaccatcttcatgtacgaaggtgcgccggaccacccggaaccc
gaccggttctgggacatgatagaacgccaccgtatcaccaccttcggcatctcgccgacc
gccatccgcgccctgcggaagtacggcgacgaagcggtcgacaaacacgacctgtcgagt
ctgcgcctcctcgggtcgaccggcgagccgtgggaccccgagtcgtggatgtggttctac
gagcacgtcggcggcggcgaggcaccgattatcaacatctccggcggcaccgaaatctgc
ggctgtttcctcatgccgatgccaacccaaccactcaaaccgtgcagtctcggcggcccc
ggactcggtatggacatcgacatcgtggactccgcgggagaatctatcgccgacacccac
gagcgcggcttcctcgtcgcccgcgactcctgtccggcgatgacgaaaagcctctggtcc
ggcgacgagcgctacctcgacacctactggtcgtcgtgggagaacctctgggaccacggc
gactgggcgcagaaggacgaagacggcttctggttcctccacggccgtgccgacgacgcc
ctcaacgtggcgggtcggaaggtcggccccgccgaggtcgaaggcgcgctcatcgaacac
gacgcggtgaatcaggccgccgccgtcggtgccgacgacgacacgaccgggaccgccgtc
gtcgcctacgtcgtcctcgaagacgacgtggaggaaaacgacgacttgcgcgagaaactc
cgcggcgtcgtcggcgaggaactgggcaagccgttccgcccgcgagagattctcttcgtc
gacgagttcccgaagacgcagtcgggcaagattatccgccgcgccatcgcctccatctac
gcgggcgaggaactcggcgacatgagcagtatcgagaatcccgaggcgctcgaaaaactc
gaacaggcgtcctga

DBGET integrated database retrieval system