KEGG   Haloferax mediterranei: HFX_2008Help
Entry
HFX_2008          CDS       T02129                                 

Gene name
aor_3
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hme  Haloferax mediterranei
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_2008 (aor_3)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HFX_2008 (aor_3)
Enzymes [BR:hme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     HFX_2008 (aor_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927552..1929246)
Genome map
AA seq 564 aa AA seqDB search
MRHAEGPLCSVDLTAWTVGTTDIDDVLESYLGGRGVGTKLVYDRVPFDASPLGPENRLVL
AAGPMQQSRMSFTGRTSLTGVSPLTDGLVSSNAGGFLSRNLVGTGYGAVEFTGAADELLA
VHVRPDGVEFEPVPDLEGEEVPAVTEYADTEWDLDAEQLICIGPAGENEVRFAAVMTTET
RAFGRGGLGAVMGSKNLKVVTFEGDDAPDVEIEFPSEAMDVHRKAATSDHAMKRQGTNAG
TDYANEVEALPTRYFSEREFEGVEGINGDAVESKKYKKGTCSQCAFACKLPTKDEAADIE
TEGPEFETMMAFGSNCAVDDIVEVMKSNDLCDRLGMDTISCGDTIAAYLMAEDEFGNVDL
IHELVEQIGYREGIGDLLAEGTHRAHEELGVHDWTVKGMDFPAHDGRHLHGQGLSFATAN
RGADHMYASFYALEYPYVEKSKAVEPHGLDGKPELLVKKENHNAVLDSGVVCKFSRDFLD
EETLATLLDTTYDRLQDVGNRIVTLERHFNNQRGFDRDDDRLPYDLPGFEHALSEYYEIR
GWSDDGVVPESAVGGTSGAAPADD
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcgacacgcggagggcccactgtgctcggtcgacctcacggcgtggacagtcgggacg
accgacatcgacgacgtactcgaatcgtacctcgggggtcgaggcgtcgggacgaaactc
gtctacgaccgcgtcccgttcgacgcctctccactcggtccggaaaatcggttggtcctc
gccgccgggccgatgcaacagtctcggatgagcttcaccggccggaccagtctgaccggc
gtctcaccgctaaccgacgggcttgtctcgtcgaacgccggaggttttctctcgcggaac
ctcgtcgggacgggctacggcgcagtcgaattcaccggcgcggccgacgaactccttgcg
gtccacgtccgacccgatggcgtcgagttcgaacccgtcccggacttggaaggggaagag
gtccctgccgttaccgagtacgcagacacggagtgggacctcgacgcggaacaactcatc
tgcatcggaccggcgggcgaaaacgaagtccgctttgcggccgtgatgacgaccgaaacg
cgggcgttcggtcgcggcggtctcggggctgtgatgggttcgaagaacctcaaagtcgtc
accttcgagggcgacgacgcgcccgacgtcgaaatcgagttcccgagcgaggcgatggat
gtccaccgcaaagccgccacctcggaccacgcgatgaagcgacagggaacgaacgccggt
accgactacgcgaacgaagtcgaggcgttgccgacgcggtacttttcagaacgtgagttc
gagggtgtcgagggaatcaacggcgacgccgtcgaatcgaagaagtacaagaaagggacc
tgctcgcagtgcgccttcgcgtgcaaactcccgaccaaagacgaggcggcagacatcgaa
accgaggggccggagttcgagacgatgatggccttcgggtcgaactgcgccgtcgacgac
atcgtcgaggtgatgaaatccaacgacctgtgtgaccgcctcggcatggataccatctcc
tgtggcgacaccatcgcggcgtacctgatggccgaagacgagttcggcaacgtcgacctg
attcacgaactcgtcgagcaaatcggctaccgcgagggcatcggcgacctgctcgcggaa
gggacccaccgcgcacacgaggaactcggcgtccacgattggacggtcaaaggcatggac
ttcccggcccacgacggtcgccatctccacggacagggtctctccttcgccacggcgaac
cgcggcgcggaccacatgtacgcctcgttctacgcgctggagtacccctacgtggagaag
tcgaaagcggtcgaaccgcacggtctcgacggcaagcccgaactcctcgtgaagaaagaa
aatcacaacgccgtcctcgacagcggcgtcgtctgtaagttctcgcgggacttcctcgac
gaggagacgctggccacgctgttggacacgacctacgaccgccttcaggacgtcggaaat
cgcatcgtcaccctcgaacgccacttcaacaaccagcgcggcttcgaccgtgacgacgat
aggctcccgtacgacctccccggattcgaacacgcactgtcagaatactacgagattcgc
gggtggagcgacgatggagtggttccggagtcggcagtgggtgggacaagtggggcggca
ccggcggacgactga

DBGET integrated database retrieval system