KEGG   Haloferax mediterranei: HFX_2029Help
Entry
HFX_2029          CDS       T02129                                 

Gene name
cofE
Definition
F420-0--gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hme  Haloferax mediterranei
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:hme00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1950625..1951443
Genome map
AA seq 272 aa AA seqDB search
MIPARFANTPLFFTAVFLPSRMELFPVPDVPEIREGDDLAALISERVDLRPGDVVCVAST
VVSKAEGRFADLDDFPAGPRARELAARLSELTDDEKDPRFAQAVLEESVDLVMDEPFLLT
ETRFGHVGVNAGIDRSNVPDHDLLLLPKRPNKSAERICAGITADRVIVSDTCGRPFRHGQ
RGVALGWAGLSASRDWRGETDRDGRELGVTVESVVDELAAAANLVQGEGDDGTPVVVVRN
FEWGDHGESEAHFRDIDGDFVRQALRDWSYEP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgataccggcccggttcgccaacaccccgttgtttttcactgccgtcttcctcccgtcc
cgtatggagttgtttcccgtccccgacgtccccgagattcgtgagggcgacgaccttgcg
gccctcatctcggagcgcgtcgaccttcgccccggtgacgtggtctgtgtcgcgtcgacg
gtcgtttcgaaggccgaagggcggttcgccgacctcgacgatttccccgccggtccgcgg
gcccgcgaactcgccgcccgactctcggaactaacggacgacgagaaggatccgcgattc
gcgcaggccgtcctcgaagagagcgtcgacctcgtgatggacgaaccgttcctcctgacc
gagacgcgattcggccacgtcggcgtcaacgccggcatcgaccggtcgaacgtccccgac
cacgacttgctgttgctccccaagcgcccgaacaagtcggccgagcgcatctgcgccggt
atcaccgccgaccgcgtcatcgtctccgatacttgcggtcgacccttcagacacggccag
cgcggcgtcgctctcggctgggccggactgagcgcgtcacgagactggcgcggcgaaacc
gaccgcgacggccgcgaactcggcgtcaccgtcgaaagcgtcgtcgacgaactcgccgcc
gcggccaacctcgtacagggcgagggcgacgacggcacgccggtcgtcgtcgtccgcaac
ttcgagtggggcgaccacggcgaaagcgaggcccacttccgcgacatcgacggcgatttc
gtgcgacaggcgctccgcgactggagctacgaaccctaa

DBGET integrated database retrieval system