KEGG   Haloferax mediterranei: HFX_2150Help
Entry
HFX_2150          CDS       T02129                                 

Gene name
acs4
Definition
acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_2150 (acs4)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_2150 (acs4)
   00620 Pyruvate metabolism
    HFX_2150 (acs4)
   00640 Propanoate metabolism
    HFX_2150 (acs4)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HFX_2150 (acs4)
   00680 Methane metabolism
    HFX_2150 (acs4)
Enzymes [BR:hme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HFX_2150 (acs4)
Lipid biosynthesis proteins [BR:hme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HFX_2150 (acs4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2082986..2084650
Genome map
AA seq 554 aa AA seqDB search
MTHNLGDYDATRADFSWDDIYTEASWNAPEELNIAHETVDRHAANGDRVALYQVDTDGEL
TTLTFWELANRSSQFANVLDDLGVEAGDRVVSYMPRIPEHYVALVGTLKHGAVWGSVNER
FGPDGISYRLDDCNASVVVTTTDNRETIADALTDAPSVEHVITVDRGDGAPTDDVVFNTA
LDDASTDYEPARTGGEDNALLYYTSGTTGLAKGVLHKHRWIAGVAATQRYAVDLQPGDVY
WSTGDLGWLTGAINTLGAWFWGSALFTYEGEFDPEMWADLLDTYPITVLFSVPTAYRMLR
EHEDVLADTDSDLRHALSIGEPLSAGVVEWAEDTLGVTVLDTYGQTETGNMIINNYPTMP
VRPGSMGKPLPGIEAAIVDPESGEVLPPGETGEIAERGDYPCFFAEYWNKPEKTRACFID
GPDGEWYLSGDLAHMDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHPAVAEAAVVP
KPHRERGNIVKAFIVPSADATPSDSLAEEIKAHVKSELSAHEYPREIEFVDELPKTVTGK
IRRTELRETAAEEN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacacacaatctcggcgactacgacgcgacgcgagccgacttctcgtgggacgacatc
tacactgaagcctcgtggaacgccccggaggaactcaatatcgctcacgaaaccgtcgac
cgacatgcggcaaacggcgaccgagtcgctctctatcaggtcgacacggacggcgaactc
acgacgctgaccttttgggaactcgcaaaccgttcgagccagttcgcgaacgtcctcgac
gacctcggcgtcgaggcgggcgaccgcgtggtctcgtacatgccgcgcattccggaacac
tacgtcgccctcgtggggacgctcaaacacggcgcagtgtggggcagcgtcaacgagcgg
ttcggtcccgacggcatctcctaccgactcgacgactgtaacgcctcggtcgtcgtcacg
acgacggacaaccgcgagaccatcgccgacgcactcaccgacgcgccgagcgtcgaacac
gtcatcacagtcgaccgcggtgacggcgcaccgaccgacgatgtggtcttcaacacggcg
ctcgacgacgccagcacggactacgaacccgcacggaccggcggcgaggacaacgcgctt
ctgtactacacctccgggacgaccgggctcgcaaagggcgtcctgcacaaacaccgctgg
attgcgggcgtcgcggcaacccagcgttacgccgtcgacctccaacccggcgacgtgtac
tggagcaccggtgacctcggctggctgacgggggcaatcaacaccctcggtgcgtggttc
tgggggtcggcactcttcacctacgaaggcgagttcgaccccgaaatgtgggcggacctg
ctcgacacctatcctatcacggtccttttctccgtcccgacggcctaccgcatgctccgc
gaacacgaagacgtgctcgcggacaccgactccgacctccgtcacgccctctccatcggc
gaacccctcagtgcgggcgtcgtcgaatgggccgaagacaccctcggcgtgaccgttctc
gacacctacggccagaccgagacggggaacatgattatcaacaactacccgacgatgccc
gtgcgaccggggtcgatgggcaagcccctccccggcatcgaggcagccatcgtcgacccc
gagtccggcgaggttctgccgccgggtgagacgggcgaaatcgccgaacgcggtgactac
ccctgtttcttcgcggagtactggaacaagcccgagaagacgcgtgcctgcttcatcgac
ggccctgacggggagtggtatctgtcgggcgacctcgcgcacatggacgaagacggctac
ttctggttcgaaggccgcgccgacgacgtgattctctcgtcgggctaccgcatcggcccg
ttcgaagtcgagagttcgcttggcgagcacccggcggtcgcagaggccgcggtcgtcccc
aagccccatcgcgaacgcgggaacatcgtcaaggcgtttatcgtcccgagtgcggatgcg
acgccgtcggactcgctcgccgaggagatcaaagcgcacgtcaaatccgaactctccgcg
cacgagtacccccgcgaaatcgagttcgtcgacgaacttccgaagactgtgacggggaag
attcggcggacggaactgcgggaaaccgcggctgaagagaactga

DBGET integrated database retrieval system