KEGG   Haloferax mediterranei: HFX_2150Help
Entry
HFX_2150          CDS       T02129                                 

Gene name
acs4
Definition
(GenBank) acyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hme  Haloferax mediterranei
Pathway
hme00010  Glycolysis / Gluconeogenesis
hme00620  Pyruvate metabolism
hme00640  Propanoate metabolism
hme00680  Methane metabolism
hme00720  Carbon fixation pathways in prokaryotes
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01130  Biosynthesis of antibiotics
hme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_2150 (acs4)
   00620 Pyruvate metabolism
    HFX_2150 (acs4)
   00640 Propanoate metabolism
    HFX_2150 (acs4)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HFX_2150 (acs4)
   00680 Methane metabolism
    HFX_2150 (acs4)
Enzymes [BR:hme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HFX_2150 (acs4)
Lipid biosynthesis proteins [BR:hme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HFX_2150 (acs4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFK19839
UniProt: I3R6H9
Position
complement(2502848..2504512)
Genome map
AA seq 554 aa AA seqDB search
MTHNLGDYDATRADFSWDDIYTEASWNAPEELNIAHETVDRHAANGDRVALYQVDTDGEL
TTLTFWELANRSSQFANVLDDLGVEAGDRVVSYMPRIPEHYVALVGTLKHGAVWGSVNER
FGPDGISYRLDDCNASVVVTTTDNRETIADALTDAPSVEHVITVDRGDGAPTDDVVFNTA
LDDASTDYEPARTGGEDNALLYYTSGTTGLAKGVLHKHRWIAGVAATQRYAVDLQPGDVY
WSTGDLGWLTGAINTLGAWFWGSALFTYEGEFDPEMWADLLDTYPITVLFSVPTAYRMLR
EHEDVLADTDSDLRHALSIGEPLSAGVVEWAEDTLGVTVLDTYGQTETGNMIINNYPTMP
VRPGSMGKPLPGIEAAIVDPESGEVLPPGETGEIAERGDYPCFFAEYWNKPEKTRACFID
GPDGEWYLSGDLAHMDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHPAVAEAAVVP
KPHRERGNIVKAFIVPSADATPSDSLAEEIKAHVKSELSAHEYPREIEFVDELPKTVTGK
IRRTELRETAAEEN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacacacaatctcggcgactacgacgcgacgcgagccgacttctcgtgggacgacatc
tacactgaagcctcgtggaacgccccggaggaactcaatatcgctcacgaaaccgtcgac
cgacatgcggcaaacggcgaccgagtcgctctctatcaggtcgacacggacggcgaactc
acgacgctgaccttttgggaactcgcaaaccgttcgagccagttcgcgaacgtcctcgac
gacctcggcgtcgaggcgggcgaccgcgtggtctcgtacatgccgcgcattccggaacac
tacgtcgccctcgtggggacgctcaaacacggcgcagtgtggggcagcgtcaacgagcgg
ttcggtcccgacggcatctcctaccgactcgacgactgtaacgcctcggtcgtcgtcacg
acgacggacaaccgcgagaccatcgccgacgcactcaccgacgcgccgagcgtcgaacac
gtcatcacagtcgaccgcggtgacggcgcaccgaccgacgatgtggtcttcaacacggcg
ctcgacgacgccagcacggactacgaacccgcacggaccggcggcgaggacaacgcgctt
ctgtactacacctccgggacgaccgggctcgcaaagggcgtcctgcacaaacaccgctgg
attgcgggcgtcgcggcaacccagcgttacgccgtcgacctccaacccggcgacgtgtac
tggagcaccggtgacctcggctggctgacgggggcaatcaacaccctcggtgcgtggttc
tgggggtcggcactcttcacctacgaaggcgagttcgaccccgaaatgtgggcggacctg
ctcgacacctatcctatcacggtccttttctccgtcccgacggcctaccgcatgctccgc
gaacacgaagacgtgctcgcggacaccgactccgacctccgtcacgccctctccatcggc
gaacccctcagtgcgggcgtcgtcgaatgggccgaagacaccctcggcgtgaccgttctc
gacacctacggccagaccgagacggggaacatgattatcaacaactacccgacgatgccc
gtgcgaccggggtcgatgggcaagcccctccccggcatcgaggcagccatcgtcgacccc
gagtccggcgaggttctgccgccgggtgagacgggcgaaatcgccgaacgcggtgactac
ccctgtttcttcgcggagtactggaacaagcccgagaagacgcgtgcctgcttcatcgac
ggccctgacggggagtggtatctgtcgggcgacctcgcgcacatggacgaagacggctac
ttctggttcgaaggccgcgccgacgacgtgattctctcgtcgggctaccgcatcggcccg
ttcgaagtcgagagttcgcttggcgagcacccggcggtcgcagaggccgcggtcgtcccc
aagccccatcgcgaacgcgggaacatcgtcaaggcgtttatcgtcccgagtgcggatgcg
acgccgtcggactcgctcgccgaggagatcaaagcgcacgtcaaatccgaactctccgcg
cacgagtacccccgcgaaatcgagttcgtcgacgaacttccgaagactgtgacggggaag
attcggcggacggaactgcgggaaaccgcggctgaagagaactga

DBGET integrated database retrieval system