KEGG   Haloferax mediterranei: HFX_2309Help
Entry
HFX_2309          CDS       T02129                                 

Gene name
speB1
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hme  Haloferax mediterranei
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HFX_2309 (speB1)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     HFX_2309 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2251618..2252430)
Genome map
AA seq 270 aa AA seqDB search
MFPGAIADREVADYVIVGAPLDISTSFQPGTRFGPNRIRRFAESFDDYDRRTDQFFTDLR
VHDAGDIRAWDDAPEYSEWLAGSVRDAVWDDAVPLILGGEHTVTAAGVTGVEPDVFVCLD
AHLDLRREYDGNEWSHATITRRVLDKLDVDEAIILGARTGSPEEWERAESDDVTVVEPEA
VADWNPDFDDESVYLSADIDAADPAFAPGTGTKEPFGLTSREMRDVVRAVAPYTDGFDVV
EVNDRDDGQAASLAAKLLREFVFSHAATDD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttccccggagccatcgcagaccgcgaggtcgctgactacgttatcgtcggtgctccg
ctcgacatctccacgtcattccaacctggaacccgttttggaccgaatcgtatccgtcgg
ttcgccgagtcgttcgacgattacgaccggcgcaccgaccaatttttcactgacttgcgc
gtccacgacgcgggagatatccgcgcgtgggacgacgcacctgaatacagcgagtggctt
gccgggagcgtccgcgacgccgtctgggacgatgccgttccgctcatccttggcggtgaa
cacaccgtcacggccgctggcgtcaccggcgtcgaacccgacgtgttcgtctgtctcgac
gcccacctcgacctccggcgcgagtacgatggcaacgaatggagtcacgccacgattacg
cgccgcgtgctcgacaaactcgacgtcgacgaggccatcattctcggcgcgcgtaccggg
tcacccgaggagtgggaacgcgccgaatcggacgacgtgaccgtcgtcgagcccgaggcg
gtcgccgactggaatccggatttcgacgacgaatcggtctatctgagcgccgatatcgac
gccgcggaccctgcgttcgcgccgggaaccgggacgaaagagccgtttggcctcacgtct
cgcgagatgcgtgacgtggttcgggcggtcgccccgtacacggacggcttcgacgtggtc
gaagtgaacgaccgagacgacggacaggcggcgtcgttggcggcgaagttgcttcgggag
ttcgtgttttcgcacgccgcgacggacgactga

DBGET integrated database retrieval system