KEGG   Haloferax mediterranei: HFX_2472Help
Entry
HFX_2472          CDS       T02129                                 

Gene name
sucC
Definition
(RefSeq) succinate--CoA ligase beta subunit (ADP-forming) (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hme  Haloferax mediterranei
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_2472 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HFX_2472 (sucC)
   00640 Propanoate metabolism
    HFX_2472 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HFX_2472 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HFX_2472 (sucC)
Enzymes [BR:hme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HFX_2472 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2416449..2417594)
Genome map
AA seq 381 aa AA seqDB search
MKLHEYQAKEIFAEAGIPVPESRLASSVEEVMEAVEDIGYPAAIKAQVHVGGRGKAGGIK
IAMDEDEARQAAEDILGMDLKGYTVEKVLVEAGVDFENELYVGITMDRSEGKPVAMVSTE
GGVNIEEVAEETPEAIAREHIDPAFGLHPYQARKIVFEAGIPRDVAFDVASFLSTLYDLY
EANDASDIEINPVMITSDRDVVAADAVMNIDDDALFRHEDLAAMEEDSYEDELEAKAGEY
GFDYVRLSGNVGIIGNGAGLVMTTLDLVDYFGGSPANFLDIGGGAKAERVANALDMVFSD
ENVDSVVFNIFGGITRGDEVAKGINEALEQFDEIPKPVVVRLAGTNAEEGMEILNTELVQ
VEGTLENAVQRAVENAQEVSQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaataccaggcgaaggaaatcttcgcagaggctgggattccggtgcca
gagtcccgtctcgcgtcgtccgtagaggaggttatggaggcggtcgaggatatcggatac
cccgccgctatcaaggcgcaggtacacgtcggtgggcgtggaaaggctggcggcatcaag
atcgccatggacgaagacgaggctcgacaggccgccgaggacatcctcggaatggacctc
aaaggctacacggtcgagaaggtactcgtcgaggccggcgtcgacttcgaaaacgaactg
tacgtgggtatcacgatggaccgaagcgagggcaagcccgtcgcgatggtctcgacggag
ggtggcgtcaacatcgaggaagtcgcagaagagacccccgaagccatcgcgcgcgagcac
atcgaccccgcgttcggcctgcacccgtaccaggcccgcaagatcgttttcgaggcggga
atcccccgcgacgtcgccttcgacgtcgcctcgttcctctcgacgctctacgacctctac
gaggccaacgacgcgtcggacatcgaaatcaaccccgtcatgattacgtccgaccgcgat
gtcgtcgctgcggacgccgtcatgaacatcgacgacgacgcgctcttccgccacgaggac
ctcgcggcgatggaagaggactcctacgaggacgaactcgaagccaaagctggcgaatac
ggcttcgactacgtccgtctgtcgggcaacgtcggtatcatcggcaacggtgccggactc
gtcatgacgacgctcgacctcgtcgactacttcggtggctcccccgccaacttcctcgac
atcggtggcggcgcgaaggccgagcgcgtggcgaacgcgctggacatggtcttctcggac
gagaacgtcgactctgtcgtcttcaacatcttcggcggcatcacccgcggtgacgaggtc
gccaagggtatcaacgaagcgctggagcagttcgacgagattccgaaaccggtcgtcgtc
cgcctcgcgggcacgaacgccgaagaggggatggagattctgaacacggaactcgtacag
gtcgaagggacgctggagaacgccgtccagcgtgccgtcgagaacgcacaggaggtgtcc
caatga

DBGET integrated database retrieval system