KEGG   Haloferax mediterranei: HFX_2564Help
Entry
HFX_2564          CDS       T02129                                 

Gene name
pcm
Definition
protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hme  Haloferax mediterranei
Brite
Enzymes [BR:hme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HFX_2564 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2503676..2504341
Genome map
AA seq 221 aa AA seqDB search
MDDDRTEQARRRLVASLREQGELYTTRVAKAMETVPRHEFVPDPVRDRAYADEPLGIGHD
QVVTAPHLVARMTELLEPRPGQRVLEIGTGSGYHAAVLAEIVGPENVFTVERVPELADAA
RDALARTDYGDVTVVVTDGSGGLPEHAPFDRINVASVAPEIPDPLFDQLADDGRMVIPLG
PRGGSQELVLVTKQDGRIERTTYGGVRFVPLIGEHGFPDDE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgaccgaaccgaacaggcgcggcggaggctcgtcgcatcgctccgcgagcag
ggcgaactctacacgacgagggttgcgaaggcgatggagaccgtcccgcggcacgagttc
gttcccgatccggtacgcgaccgcgcctacgcggacgaaccgctcggcatcggccacgac
caggtcgtgaccgcgccgcacctcgttgcacggatgaccgaactgctcgaaccgcgaccg
ggacagcgcgtcctcgaaatcgggacgggaagcggctaccacgccgccgttctcgcggag
attgtcggccccgagaacgtcttcactgtcgaacgagttcccgaactcgcagatgctgca
cgggacgctctcgctcggactgactacggtgacgtgacggtggtcgtcacagacgggtct
ggcgggttacccgaacacgcccccttcgatagaatcaacgtggcgtcggtcgcaccggaa
attcccgacccgcttttcgaccaactcgctgacgacgggcggatggtcattccactcggc
ccccgcggcgggtcacaagagttggtattagtaacgaaacaggatgggagaatcgaacgg
acgacttacggcggcgttcggttcgtcccgctcatcggagaacacgggttccccgacgac
gagtga

DBGET integrated database retrieval system