KEGG   Haloferax mediterranei: HFX_2626Help
Entry
HFX_2626          CDS       T02129                                 

Gene name
suk
Definition
(GenBank) sugar kinase, ribokinase (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
hme  Haloferax mediterranei
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HFX_2626 (suk)
Enzymes [BR:hme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HFX_2626 (suk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2034488..2035399)
Genome map
AA seq 303 aa AA seqDB search
MSRVICAGHVNWDVTLRVDALPDPDGEATVESRVGAGGGSAANVASGLVGLGVPSSLLGS
VGDDEHGHAAVAELASKGVDCRYVERVDHGPTTVKYVVVDAAGEVFVLGSPGVNEAFEAS
NLPAESLAAADHLHLTSQAPATAAALARRATEVGTTVSFDPGRRIGDRGYTDALRQVDFV
FLNDREAATALGEASANDSNAATNGSAVAKVLEQTTLVLKHGPNGAEVRDDGEQHVHPGY
PIDAVDTTGAGDAFASGFIAARIEGTSYERALTIANACGALTAAEPGARTQLSWQRLDDL
IDG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgtcatctgcgccggccacgtgaactgggacgtcaccctccgcgtggacgca
ctccccgacccagacggtgaggcgaccgtcgagtcacgtgtcggcgctggcggcggaagc
gccgccaacgttgccagcggtctcgtcggcctgggcgttccgtcgtcacttctcgggagc
gtcggcgacgacgaacacggccacgccgccgtcgccgaactcgcctcgaaaggggtcgac
tgccggtacgtcgaacgtgtcgaccacggcccgacgaccgtcaagtacgtcgtcgtcgac
gccgcgggcgaggtgttcgtcctcgggtctcccggcgtcaacgaggcgttcgaggcgtcg
aatttgccagccgaatcgctggccgccgccgaccacctccacttgacgagtcaggcacca
gcgacggctgccgcgctcgcccgccgagccaccgaagtcgggacgacggtcagtttcgac
cccgggcggcgcatcggcgaccggggctacaccgacgcgcttcgacaggtcgatttcgtc
ttcctcaacgaccgcgaggccgcgaccgcactcggtgaagccagcgcgaacgacagcaac
gccgccacgaacggaagcgcagtcgccaaggtactcgaacagaccacactcgtcctcaaa
cacgggccgaacggtgcagaagttcgagacgacggtgagcaacacgtccatccgggatat
cccatcgacgccgtggacacgaccggtgcgggcgatgcgttcgcttcgggtttcatcgcc
gcccgaatcgagggaacatcctacgagcgggcacttaccatcgcaaacgcgtgcggcgcg
ctgaccgcggccgaacccggtgcgcgaacacaactgagttggcagcgactagacgacctt
atcgacggctaa

DBGET integrated database retrieval system