KEGG   Haloferax mediterranei: HFX_2691Help
Entry
HFX_2691          CDS       T02129                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hme  Haloferax mediterranei
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hme01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hme00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2619714..2621000
Genome map
AA seq 428 aa AA seqDB search
MNIEVRELADLGPDARRAFFERDAGVGDVRSDVRDIVERVRREGDVALRDYSREFDDVEV
GNIDVSDAAERAYDEIDDDVREAIETAAANIREFHERQVPEDWREDFGASGTRELGRRYR
PLDRVGVYAPGGTAAYPSSVLMGVIPAKVAGVEHVAVATPPADTMNPVTLAAMHVAGADA
VYSVGGAQGIAALAYGTETVKAVQKVVGPGNKWVTAAKAEVRGDVDIDFLAGPSEVLVVA
DETAEARFVAADLVAQAEHDPNASVVAVTDDADLATEIVEEVERQAAERERTETIEAALE
NDASGVLVARSMSEAVLFAEEYAAEHLSIQADDDEALLDRIDSAGSVFLGPYTPVAAGDY
ASGTNHVLPTGAGAKQQGGLSVDHFVRSTTVQRLDQEALSGLSETVTTLAEAEGLDAHAQ
SVRERFEE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaggttcgcgaactggccgacctcggccccgacgctcgccgcgccttcttc
gaacgagacgccggcgtcggcgacgttcgctccgacgtacgcgacatcgtcgaacgagtc
cgcagggagggcgacgttgcgctccgggactactcccgcgagttcgacgacgtcgaagtc
ggcaacatcgacgtgagcgacgcggccgaacgcgcctacgacgaaatcgacgacgacgtg
cgcgaagctatcgagacggcggcggcgaacatccgcgaattccacgagcgacaggtcccc
gaagactggcgcgaggacttcggcgcttccggcacgcgcgaactcgggcgacgctaccgc
ccccttgaccgcgtcggcgtctacgcacccggcggtaccgcagcctacccgtccagcgtt
ctcatgggtgtcatccccgccaaagtcgcgggcgtcgagcacgtcgcggtcgccacgcca
ccggccgacacgatgaaccccgtcaccctcgctgcaatgcacgtcgcgggtgctgacgcg
gtgtactctgttggtggcgcacaaggcatcgccgctctcgcctacgggacagagaccgtg
aaggccgtccagaaggtcgtcggcccgggcaacaagtgggttacggccgcgaaggccgag
gttcgcggcgacgttgacatcgacttcctcgccggtccctccgaggtactcgtcgtcgcc
gacgagaccgcagaggcgcgattcgtcgcggccgacctcgtcgcacaggccgaacacgac
ccgaacgcttccgtggtcgccgtcaccgacgacgccgacctcgccacagaaatcgtcgag
gaggtcgagcgacaggccgcagagcgcgaacgcaccgagaccatcgaggcagcgctggag
aacgacgcttcgggcgtgctcgtcgcccgctcgatgtccgaagcggtgctcttcgccgaa
gagtacgccgcagagcacctgtcgattcaggccgacgatgacgaagctctcctcgaccgt
atcgactcggccggaagcgtcttcctcggtccgtacaccccagtcgccgcgggcgactac
gcctccggaacgaaccacgtgctaccgactggtgccggtgcgaagcaacagggcggactc
tcggtggaccacttcgtccgctcgacaactgtccagcgactcgaccaggaggcgctttcg
ggcctctcagagacggttacgacgctcgccgaagcggaaggactcgacgcgcacgcacag
agcgtccgcgaacggttcgaggagtaa

DBGET integrated database retrieval system