KEGG   Haloferax mediterranei: HFX_2771Help
Entry
HFX_2771          CDS       T02129                                 

Gene name
celM
Definition
cellulase, endo-1,3(4)-beta-glucanase, peptidase M42 family protein / endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hme  Haloferax mediterranei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HFX_2771 (celM)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     HFX_2771 (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2689128..2690192)
Genome map
AA seq 354 aa AA seqDB search
MEDDRREFLEDLLTTPSPSGYETDGQRVWIDYVSQFADDVTVDAYGNAVAVHEGSGDGPE
IAFTGHADQIGYIVRDIDDDGFVRIGPIGGADRTVSKGQHVTVHADGGDVHGVIGQTAIH
LRDVGEEEYDDLEEQFVDIGATSKDEANDYVEVGDPVTVEARVRDLAGDRVAANGMDNRV
GTWSAAEGLRAAVENDVDATVYAVSTVQEEVGVQGAKMVGYDLNPDAVVAVDVTHATDNP
DVPGKQKGPVELAEGPVISRGSANHPNVVALARDAADEADIDVQLQADGIRTGTDADAFY
TSRSGIPSLNIGIPNRYMHTPVEVISTTDLDDVAALLGSIAALAGDVESFGVEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaccgacgcgaatttctcgaagacctgcttaccacaccaagtccgtccggc
tacgagaccgacggacagcgcgtgtggatagactacgtctcccagtttgcagacgacgta
accgtcgacgcgtacggtaacgctgtcgcggttcacgaaggctccggcgacggccccgaa
atcgcctttaccggccacgccgaccagattggctacatcgtccgcgacatcgacgatgac
ggcttcgtccgcatcggtcccatcggcggtgccgaccgaaccgtctcgaagggccagcac
gtgacagttcacgccgacggaggcgatgtccacggcgtcatcggccagactgccatccac
ctccgcgacgttggagaggaagaatacgacgacctcgaagagcagttcgtcgatatcggc
gcgacgagcaaggacgaggcgaatgactacgtcgaagtcggcgaccccgtgacggtcgaa
gcacgagtccgcgacctcgcgggcgaccgcgtcgcagccaacgggatggacaaccgcgtc
ggcacgtggtcggccgccgaaggacttcgcgctgccgtcgagaacgacgtggacgcgacg
gtatacgccgtcagcacggtacaagaggaagtcggcgtgcaaggtgcgaagatggtcggc
tacgacctcaatcccgacgcggtggtcgcggtcgacgtaacgcacgcaaccgacaacccg
gacgtaccgggcaagcagaaaggaccggtcgaactcgctgagggaccggttatctcccgc
gggagcgcgaatcacccgaacgtcgtcgcactcgcccgcgacgcggctgacgaggccgac
atcgacgtacagctacaggccgacggcatccgcacgggtacggacgcggacgctttctac
acgagtcgctccggcattccctccctcaacatcggcatcccgaaccgctacatgcacacg
ccggtcgaagtcatctcgacgaccgacctcgacgacgtggccgcgcttctcgggtcgata
gcggcgctcgctggcgacgttgagtcgttcggcgtcgaactgtaa

DBGET integrated database retrieval system