KEGG   Haloferax mediterranei: HFX_2771Help
Entry
HFX_2771          CDS       T02129                                 

Gene name
celM
Definition
(GenBank) cellulase, endo-1,3(4)-beta-glucanase, peptidase M42 family protein / endoglucanase
Organism
hme  Haloferax mediterranei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1897306..1898370
Genome map
AA seq 354 aa AA seqDB search
MEDDRREFLEDLLTTPSPSGYETDGQRVWIDYVSQFADDVTVDAYGNAVAVHEGSGDGPE
IAFTGHADQIGYIVRDIDDDGFVRIGPIGGADRTVSKGQHVTVHADGGDVHGVIGQTAIH
LRDVGEEEYDDLEEQFVDIGATSKDEANDYVEVGDPVTVEARVRDLAGDRVAANGMDNRV
GTWSAAEGLRAAVENDVDATVYAVSTVQEEVGVQGAKMVGYDLNPDAVVAVDVTHATDNP
DVPGKQKGPVELAEGPVISRGSANHPNVVALARDAADEADIDVQLQADGIRTGTDADAFY
TSRSGIPSLNIGIPNRYMHTPVEVISTTDLDDVAALLGSIAALAGDVESFGVEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaccgacgcgaatttctcgaagacctgcttaccacaccaagtccgtccggc
tacgagaccgacggacagcgcgtgtggatagactacgtctcccagtttgcagacgacgta
accgtcgacgcgtacggtaacgctgtcgcggttcacgaaggctccggcgacggccccgaa
atcgcctttaccggccacgccgaccagattggctacatcgtccgcgacatcgacgatgac
ggcttcgtccgcatcggtcccatcggcggtgccgaccgaaccgtctcgaagggccagcac
gtgacagttcacgccgacggaggcgatgtccacggcgtcatcggccagactgccatccac
ctccgcgacgttggagaggaagaatacgacgacctcgaagagcagttcgtcgatatcggc
gcgacgagcaaggacgaggcgaatgactacgtcgaagtcggcgaccccgtgacggtcgaa
gcacgagtccgcgacctcgcgggcgaccgcgtcgcagccaacgggatggacaaccgcgtc
ggcacgtggtcggccgccgaaggacttcgcgctgccgtcgagaacgacgtggacgcgacg
gtatacgccgtcagcacggtacaagaggaagtcggcgtgcaaggtgcgaagatggtcggc
tacgacctcaatcccgacgcggtggtcgcggtcgacgtaacgcacgcaaccgacaacccg
gacgtaccgggcaagcagaaaggaccggtcgaactcgctgagggaccggttatctcccgc
gggagcgcgaatcacccgaacgtcgtcgcactcgcccgcgacgcggctgacgaggccgac
atcgacgtacagctacaggccgacggcatccgcacgggtacggacgcggacgctttctac
acgagtcgctccggcattccctccctcaacatcggcatcccgaaccgctacatgcacacg
ccggtcgaagtcatctcgacgaccgacctcgacgacgtggccgcgcttctcgggtcgata
gcggcgctcgctggcgacgttgagtcgttcggcgtcgaactgtaa

DBGET integrated database retrieval system