KEGG   Haloferax mediterranei: HFX_2825Help
Entry
HFX_2825          CDS       T02129                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, subunit D (membrane anchor protein)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hme  Haloferax mediterranei
Pathway
hme00020  Citrate cycle (TCA cycle)
hme00190  Oxidative phosphorylation
hme00650  Butanoate metabolism
hme00720  Carbon fixation pathways in prokaryotes
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01130  Biosynthesis of antibiotics
hme01200  Carbon metabolism
Module
hme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hme_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HFX_2825 (sdhD)
   00650 Butanoate metabolism
    HFX_2825 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HFX_2825 (sdhD)
   00720 Carbon fixation pathways in prokaryotes
    HFX_2825 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AFK20497
UniProt: I3R8D7
Position
1850259..1850630
Genome map
AA seq 123 aa AA seqDB search
MAERYTSFEPGGRRWLWQRLTAAFLVVVLAFHFFLLHFLNHADEVTFALSQGRMENLTYF
SLMILFLVTATFHGVNGVYNALVNQGLSGTRKTAVKAILGFASVVLIVQGVRTALAWAGG
VPI
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacgatacacgtctttcgagcctggcggacgtcggtggctgtggcaacgcctc
accgccgcgttcctcgtagtcgtattggcattccacttcttcctactgcacttcctcaac
cacgcggacgaagtgacgttcgccctctcacaggggcggatggagaacctgacgtacttc
tcgctgatgattctgtttctcgtcaccgcgacgttccacggggtcaacggcgtctacaac
gccctcgtcaatcagggcctctcaggcacccgtaagacggcggtcaaggcgattctcggc
ttcgcgagtgtcgtcctcatcgtgcagggcgtccgtactgcactcgcgtgggccggaggt
gttcccatctaa

DBGET integrated database retrieval system