KEGG   Haloferax mediterranei: HFX_2882Help
Entry
HFX_2882          CDS       T02129                                 

Gene name
hat
Definition
histone acetyltransferase-like protein (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hme  Haloferax mediterranei
Brite
Enzymes [BR:hme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HFX_2882 (hat)
Transfer RNA biogenesis [BR:hme03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HFX_2882 (hat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2792053..2793705)
Genome map
AA seq 550 aa AA seqDB search
MSAETETESEAFQRTCEALVERILAGEIDRDDLESAKLDACSEHSSPKVPKNTEILQYAP
KDRREEVKEVVRRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHE
PAAARGVQNDYDPYGQVTLRLEQLRHIGHPVDKVELILMGGTMTARSHDYQEWFVKRALE
AMNDYDLDSEPQPAEDQSFKPDPEDVEFKYVEDVIAENETADIRNIGTTFETKPDWCDPE
QIDRMLDLGATKVEVGVQTTYERINREMHRGHGVQASIDANRRLRDSAFKVGFHMMPGQP
GMTKEMCLEDFRQLFENSDWRPDYLKIYPTLIVRDTITYDMWRRDEYDPLNNEEAADIIA
EVMGMIPKYTRLQRVQRDIPADFIDAGVWKSNLRQLAAQRAEEKGIVQRNIRAREVGMNE
ANPDPERIELDVMTYEVAGGTEHFISFEDPVEDLLVGFCRLRFPGNPVRRELQNAALVRE
LHVYGSEVGIGAEGDWQHKGYGKKLLAHAEELARDAGYDKISVISGIGVRQYYKQKLGYQ
QDGPYVSKRL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctgagaccgaaaccgagtccgaggcgttccagcggacctgcgaggcgctcgtc
gagcgcatcctcgcgggcgaaatcgaccgcgacgacctcgaatcggccaagctcgacgcc
tgttcggaacactcctcgccgaaggtaccgaagaacaccgagattctacaatacgccccc
aaagaccgacgcgaggaggtcaaagaggtcgttcgacgaaaacccgtccgcaccgcctcc
ggcgtctcgccggtcgccatcatgacctcgccgcacatgtgcccgcacgggaagtgtctg
tactgtcccggcggtccggcgagcgagttctcgtcgtcgcagtcgtacacgggccacgaa
cccgcggccgcccgcggcgtccagaacgactacgacccgtacggacaggtcacgctccga
ctcgaacaactccggcacatcggccacccggtcgacaaggtcgaactcatcctgatgggc
gggacgatgaccgcccggagccacgactaccaggagtggttcgtcaagcgggcgctcgaa
gcgatgaacgactacgacctcgactcggaaccgcagcccgccgaggaccaatcgttcaaa
cccgaccccgaggatgtcgaatttaaatacgtcgaagacgtgattgccgaaaacgagacg
gccgacatccgaaacatcggaacgacgttcgagacgaagcccgactggtgcgaccccgag
caaatcgaccggatgctcgatttgggtgcgacgaaggtcgaagtcggcgtccagacgacc
tacgagcgaatcaaccgcgagatgcaccgcggtcacggcgtgcaggcgtcaatcgacgcc
aaccgtcgcctccgcgactcggcgttcaaggtcggcttccacatgatgccgggacaaccc
gggatgacgaaggagatgtgtctggaggacttccgccaactgttcgagaactcggactgg
cggccagactacctcaaaatctacccgacgctcatcgtccgcgacaccatcacctacgac
atgtggcgacgcgacgagtacgacccgctgaacaacgaggaggccgccgacatcatcgcc
gaggtcatggggatgattccgaagtacacgcgcctccagcgcgtccagcgcgacatccca
gcggacttcatcgacgccggtgtctggaagtctaacctccgacaactcgccgctcagcgg
gccgaagagaagggtatcgtccagcgcaacatccgcgcccgcgaggtcggcatgaacgaa
gccaacccggacccagagcgcatcgaactcgacgtgatgacctacgaggtcgctggtgga
actgagcacttcatctcgttcgaagaccccgtcgaggacctgctcgtcggattctgtcga
cttcgtttcccgggcaatccggtccgacgcgaactccagaacgcggcgctcgtccgcgaa
ctgcacgtctacgggtcggaagtcggtatcggagctgagggcgattggcagcacaaaggc
tacggaaagaagcttctcgcccatgccgaggaactcgcccgcgacgctggatacgacaag
atttcggtcatctcgggtatcggtgtccggcagtactacaagcagaaactcggctaccaa
caggacggtccgtacgtgtcgaagcggctgtag

DBGET integrated database retrieval system