KEGG   Haloferax mediterranei: HFX_2904Help
Entry
HFX_2904          CDS       T02129                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hme  Haloferax mediterranei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hme00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2816820..2817968
Genome map
AA seq 382 aa AA seqDB search
MRTVDAAGLKIGDDHPPRIMGVLNVSKESPYKPSVFNDPSEAAEYVDSELIDEGADIVDV
GLESANKRLDVLSAEDELERLDTALSVLDHVSGDAVFSIETRYHEVAEAALEQGFDMVND
ICGFADPEMPRVCEEFDAAVAKMASPPDLTCPGAIEEVDDIYDALERNGFTDKTIVDPAF
GGWSEAKTLEHDRETFDRLREFRGYGYPILVSINRKNFLRDVAGRSTEDALPVSLAATSM
AVERGAHIIRTHDVRETRDAALIGHEFKRRRVREPGDVSVEELDVTTPREAARHLDRIGA
NRDFATESVTRVFELEGLSADDREELAAAAADAGAVLAGGDTGSTGALLIGTPAALDRLE
HVVADASPALEAALETMTQTVN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgtcgatgcggcaggactcaaaatcggcgacgaccacccaccgcgaatcatg
ggtgtgctgaacgtctcgaaggagtctccgtacaagccgagcgtgttcaacgacccgagc
gaggccgccgagtacgtcgacagcgaactcatcgacgagggtgctgatatcgtcgatgtc
ggcctcgaatcggcgaacaagcgactcgacgtgctctcggccgaagacgaactcgaacgc
ctcgacacggcgctttcggtcctcgaccacgtctccggggacgccgtgttctctatcgaa
acgcggtaccacgaggtcgcggaggcggcactcgaacaaggcttcgacatggtcaacgac
atctgcggattcgccgacccggagatgccgcgagtatgcgaggagttcgacgccgccgtg
gccaagatggcgagtccgccggacctcacctgtcccggcgctatcgaagaagtcgatgat
atctacgacgcgctcgaacgcaacggtttcaccgacaagactatcgtcgacccggcgttc
ggcggctggtcggaagcaaagaccctcgaacacgaccgcgagacgttcgaccgcctccgt
gagttccgcggatacggctaccccattttggtctctatcaatcggaagaacttcctccgc
gacgttgctggccggtcgaccgaagacgcgcttcccgttagccttgccgccacgtcgatg
gcggtcgaacgcggtgcacacatcattcgaactcacgacgtacgagagacgcgcgatgcg
gcgctcatcggccacgagttcaaacgccggcgcgtccgcgaacccggcgacgtttccgtc
gaagaactggacgtaacgacgcccagagaagccgcccggcatctcgaccgaatcggcgca
aaccgagatttcgctaccgagagtgtcacccgcgtcttcgaactcgaagggctcagcgcc
gacgaccgggaagaactcgccgccgccgctgccgacgcaggtgccgtcttggccgggggc
gacacgggctcgacgggtgcgctcctcatcggtacgcccgcagcactcgaccgactcgaa
cacgtcgtcgccgacgcctcgccggctctcgaagcagcgttagagacaatgacacagacg
gtcaactga

DBGET integrated database retrieval system