KEGG   Haloferax mediterranei: HFX_2954Help
Entry
HFX_2954          CDS       T02129                                 

Gene name
pdhC
Definition
dihydrolipoamide S-acyltransferase (pyruvate dehydrogenase E2 component) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_2954 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_2954 (pdhC)
   00020 Citrate cycle (TCA cycle)
    HFX_2954 (pdhC)
   00620 Pyruvate metabolism
    HFX_2954 (pdhC)
Enzymes [BR:hme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFX_2954 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2866394..2867896
Genome map
AA seq 500 aa AA seqDB search
MALKEFKLPDVGEGVAEGELVTWHVAPGDEVTEDQVLAEVETDKALVDVPSPFNGTVKEL
LAEEGEMVPVGNVIITIQVGGEEEAETAEPEAEAEPEAPAAEESGEAESGGRVFASPSVR
RLARELDVDLASVDGSGPSGRVTEGDVRSAAEAAEAAEEAESSRPRNVEINGESATEKRD
EGTAAVAESADRQQTLAAPATRALAEEKSVDLNAVPATEMRDGEAFVTPEAVSEYAQAQQ
QAQAADAEAVSAEAEAGTAATETAEAGPAAGERVPYKGVRKAIGNQMEQSKYTAPHVTHH
DEVDVTELVELRSQLKPVAEEQETKLTYMPFVMKAVIAALKDFPYMNSQLDEENEEIVLR
DEYNIGVAAATDAGLMVPVVHDADRKGMLQLADEMNEKVQKARDRKISPAEMRGGTFTIT
NIGGIGGEYATPIINYPEVAILALGAIKDKPRVVDGEVVPRKVLTLSLSFDHRIVDGAQG
ARFTNRVKELLEDPKLLVLE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaggaattcaaactccccgacgtcggtgaaggcgtcgcagaaggcgaactc
gtaacgtggcacgtcgcaccgggcgacgaagtaactgaggaccaggtactcgcagaggtc
gagaccgacaaggcactcgtcgacgttccctcgccgttcaacgggacggtcaaagaacta
ctcgcagaagagggcgaaatggtccccgtcggcaacgtcatcatcactattcaggtcggt
ggcgaagaagaggccgaaacagccgaacccgaggctgaggcagaacccgaagcaccggcc
gcggaggaaagcggcgaagccgaatccggcgggcgcgtgttcgcctcgccgagcgtccga
cgcctcgcccgggaactcgacgtcgacctcgcgtccgtcgacggcagcggtccgagcggt
cgcgtgaccgaaggcgacgttcgttcggccgccgaggcggccgaggctgccgaggaagcg
gagagtagccgtccgcgcaacgtcgagataaacggagagtccgcgaccgaaaagcgcgac
gagggcactgcggcagtagcagagagcgctgaccgccagcagaccctcgccgcgcccgca
acccgtgcactggccgaagagaagagcgtcgacctcaacgccgttcccgcgaccgaaatg
cgcgacggcgaggcgttcgtcacgcccgaggctgtcagcgagtacgcacaggcccagcaa
caggcgcaggccgcggacgccgaagccgtctctgcggaagccgaggcaggtactgcggcg
accgagaccgccgaagccggtcccgccgctggcgagcgcgtcccctacaagggcgtccgc
aaagctatcggcaaccagatggagcagtcgaagtacactgcgccgcacgtcacgcaccac
gacgaagtggacgtgaccgaactcgtcgaacttcgctcgcagctcaagcccgtcgccgag
gaacaggagacgaagctcacctacatgccgttcgtgatgaaggcggtcatcgcggcgctg
aaggacttcccgtacatgaactcccaactcgacgaggagaacgaggaaatcgtcctccgc
gacgagtacaacatcggtgtcgccgccgcgacggacgccggtctcatggtcccggtcgtc
cacgacgccgaccgcaagggcatgctccaactcgcagacgagatgaacgagaaggtccag
aaggcccgcgaccgcaagatttcgcccgcagagatgcgcggtggtaccttcaccatcacc
aacatcggcggcatcggcggcgagtacgcgacgcccatcatcaactacccagaagtggcg
attctcgcgctcggagccatcaaagacaagccacgtgtggttgacggtgaagtcgtgcca
cgaaaggttctcacactctcgctttcgttcgaccaccgcatcgtcgacggcgcacagggt
gctcgcttcacgaaccgtgtgaaggaactactcgaagaccccaagctgttggtgctcgaa
taa

DBGET integrated database retrieval system