KEGG   Haloferax mediterranei: HFX_2954Help
Entry
HFX_2954          CDS       T02129                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide S-acyltransferase (pyruvate dehydrogenase E2 component)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hme  Haloferax mediterranei
Pathway
hme00010  Glycolysis / Gluconeogenesis
hme00020  Citrate cycle (TCA cycle)
hme00620  Pyruvate metabolism
hme01100  Metabolic pathways
hme01110  Biosynthesis of secondary metabolites
hme01120  Microbial metabolism in diverse environments
hme01130  Biosynthesis of antibiotics
hme01200  Carbon metabolism
Module
hme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_2954 (pdhC)
   00020 Citrate cycle (TCA cycle)
    HFX_2954 (pdhC)
   00620 Pyruvate metabolism
    HFX_2954 (pdhC)
Enzymes [BR:hme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFX_2954 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFK20618
UniProt: I3R8Q8
Position
2866394..2867896
Genome map
AA seq 500 aa AA seqDB search
MALKEFKLPDVGEGVAEGELVTWHVAPGDEVTEDQVLAEVETDKALVDVPSPFNGTVKEL
LAEEGEMVPVGNVIITIQVGGEEEAETAEPEAEAEPEAPAAEESGEAESGGRVFASPSVR
RLARELDVDLASVDGSGPSGRVTEGDVRSAAEAAEAAEEAESSRPRNVEINGESATEKRD
EGTAAVAESADRQQTLAAPATRALAEEKSVDLNAVPATEMRDGEAFVTPEAVSEYAQAQQ
QAQAADAEAVSAEAEAGTAATETAEAGPAAGERVPYKGVRKAIGNQMEQSKYTAPHVTHH
DEVDVTELVELRSQLKPVAEEQETKLTYMPFVMKAVIAALKDFPYMNSQLDEENEEIVLR
DEYNIGVAAATDAGLMVPVVHDADRKGMLQLADEMNEKVQKARDRKISPAEMRGGTFTIT
NIGGIGGEYATPIINYPEVAILALGAIKDKPRVVDGEVVPRKVLTLSLSFDHRIVDGAQG
ARFTNRVKELLEDPKLLVLE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaggaattcaaactccccgacgtcggtgaaggcgtcgcagaaggcgaactc
gtaacgtggcacgtcgcaccgggcgacgaagtaactgaggaccaggtactcgcagaggtc
gagaccgacaaggcactcgtcgacgttccctcgccgttcaacgggacggtcaaagaacta
ctcgcagaagagggcgaaatggtccccgtcggcaacgtcatcatcactattcaggtcggt
ggcgaagaagaggccgaaacagccgaacccgaggctgaggcagaacccgaagcaccggcc
gcggaggaaagcggcgaagccgaatccggcgggcgcgtgttcgcctcgccgagcgtccga
cgcctcgcccgggaactcgacgtcgacctcgcgtccgtcgacggcagcggtccgagcggt
cgcgtgaccgaaggcgacgttcgttcggccgccgaggcggccgaggctgccgaggaagcg
gagagtagccgtccgcgcaacgtcgagataaacggagagtccgcgaccgaaaagcgcgac
gagggcactgcggcagtagcagagagcgctgaccgccagcagaccctcgccgcgcccgca
acccgtgcactggccgaagagaagagcgtcgacctcaacgccgttcccgcgaccgaaatg
cgcgacggcgaggcgttcgtcacgcccgaggctgtcagcgagtacgcacaggcccagcaa
caggcgcaggccgcggacgccgaagccgtctctgcggaagccgaggcaggtactgcggcg
accgagaccgccgaagccggtcccgccgctggcgagcgcgtcccctacaagggcgtccgc
aaagctatcggcaaccagatggagcagtcgaagtacactgcgccgcacgtcacgcaccac
gacgaagtggacgtgaccgaactcgtcgaacttcgctcgcagctcaagcccgtcgccgag
gaacaggagacgaagctcacctacatgccgttcgtgatgaaggcggtcatcgcggcgctg
aaggacttcccgtacatgaactcccaactcgacgaggagaacgaggaaatcgtcctccgc
gacgagtacaacatcggtgtcgccgccgcgacggacgccggtctcatggtcccggtcgtc
cacgacgccgaccgcaagggcatgctccaactcgcagacgagatgaacgagaaggtccag
aaggcccgcgaccgcaagatttcgcccgcagagatgcgcggtggtaccttcaccatcacc
aacatcggcggcatcggcggcgagtacgcgacgcccatcatcaactacccagaagtggcg
attctcgcgctcggagccatcaaagacaagccacgtgtggttgacggtgaagtcgtgcca
cgaaaggttctcacactctcgctttcgttcgaccaccgcatcgtcgacggcgcacagggt
gctcgcttcacgaaccgtgtgaaggaactactcgaagaccccaagctgttggtgctcgaa
taa

DBGET integrated database retrieval system