KEGG   Haloferax mediterranei: HFX_2983Help
Entry
HFX_2983          CDS       T02129                                 

Gene name
cpsG
Definition
phosphohexomutase (phosphoglucomutase, phosphomannomutase) (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_2983 (cpsG)
   00030 Pentose phosphate pathway
    HFX_2983 (cpsG)
   00051 Fructose and mannose metabolism
    HFX_2983 (cpsG)
   00052 Galactose metabolism
    HFX_2983 (cpsG)
   00500 Starch and sucrose metabolism
    HFX_2983 (cpsG)
   00520 Amino sugar and nucleotide sugar metabolism
    HFX_2983 (cpsG)
  Nucleotide metabolism
   00230 Purine metabolism
    HFX_2983 (cpsG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HFX_2983 (cpsG)
Enzymes [BR:hme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HFX_2983 (cpsG)
    5.4.2.8  phosphomannomutase
     HFX_2983 (cpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2893415..2894779
Genome map
AA seq 454 aa AA seqDB search
MKLFGSSGTRGVVGESLTPEFVLRVAKAAGTVWNVDRVAIARDTRTTGEMFVNAAMSGLA
SVGVDVDDLGVVPTPAAVKYCEDEAVPGVVITASHNPPEFNGVKLVGDDGVELAVEELER
IEDHILAEEFDVVAWDEVGDTRTIETVNDDYREELLASIDREAIAEANLTVALDPGHGAG
SLVSPDLLRELGCEVRTVNAQPDGHFPGRESEPVPENLRDLERLVRATDADVGIAHDGDA
DRAIFVNEHGESISGEASLAALAAAALEPGDVTVSAVNVSQRLVDVCEEVGADLELTPIG
ATNLITRIRELWREGKTVPVAGEGNGGIFFPNYRLVRDGAYIAAKFLELVAERPASEVVA
PYQDYYNVRINLEYAEESELTAMLNAADEYAQSADATPNTTDGYRLDYGDAWVLVRPSGT
EPKVRVYAEGRTEERATELAEDAADALRAAVDDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttcggttccagcgggacgcggggcgtggttggtgagagcctcaccccggag
ttcgtccttcgcgtcgcgaaggccgctggcacggtctggaacgtcgaccgcgttgccatc
gcacgtgacacacgaactacaggggaaatgttcgtcaacgcagccatgtccggcctcgcc
agcgtcggcgtcgacgtagacgacctcggtgtcgttccgacgcccgccgccgtcaagtac
tgcgaggacgaggccgttccgggcgtcgtcatcacggcgtcgcacaacccacccgagttc
aacggcgtcaaactcgtcggcgacgacggcgtcgaactcgccgtcgaggagttagaacgc
atcgaagaccacatcctcgccgaggaattcgacgtggtcgcgtgggacgaagttggggac
acccgcaccatcgagacggtcaacgacgattatcgcgaagaactcctcgcgagcatcgac
cgcgaggcaatcgcggaggcgaatctcaccgttgcactcgaccccggccacggagccggg
tcgctcgtctcacccgacttactccgcgaactcggctgtgaggtccgcaccgtcaacgcc
caacccgacggccacttccccggccgcgagtccgaaccggtgcccgagaacctccgcgac
ctcgaacgactcgtccgcgcgactgacgccgacgtgggaatcgcccacgacggcgacgcg
gaccgggccatcttcgtgaacgaacacggcgaaagcatctccggtgaggcatcactcgcc
gccctcgcggccgccgccctcgaaccgggcgacgtgaccgtctctgccgtgaacgtctcc
cagcgactcgtcgacgtgtgcgaggaagtcggtgccgacctcgaactcacgcctatcggc
gcgacgaatctcatcactcgcatccgcgaactctggcgcgagggcaaaaccgtccccgtc
gccggtgagggtaacggaggcatcttcttcccgaactaccgtctcgtccgcgacggcgcg
tacatcgcggcgaagttcctcgaactcgtcgccgagcgccccgcgagcgaggtcgtcgca
ccgtatcaggactactacaacgtccgcatcaacctcgaatacgccgaagagtcggaactg
acggccatgctgaacgccgccgacgagtacgcccagtccgccgatgcgacgccgaacacg
accgacggttaccgcctcgactacggcgacgcgtgggtgctcgtacgaccctcgggaacc
gaaccgaaagttcgcgtctacgccgaaggccgaaccgaagaacgagcgaccgaactcgcc
gaagacgccgcagacgcactccgcgccgcagtcgacgacctatag

DBGET integrated database retrieval system