KEGG   Haloferax mediterranei: HFX_5029Help
Entry
HFX_5029          CDS       T02129                                 

Gene name
amy6
Definition
beta-D-glucosidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hme  Haloferax mediterranei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HFX_5029 (amy6)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HFX_5029 (amy6)
Enzymes [BR:hme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HFX_5029 (amy6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM300:complement(29689..31281)
Genome map
AA seq 530 aa AA seqDB search
MADNVLTAERPVHAVPLEEKVGQLFVAGFDGVEPTDDIEQLVSSHHLGGIIYFSRNIESP
SQVASLSERLQTIAREAGEPPLLIATDQEGGVVSRFDWGAQLPSQMALGATQDPTRLRSA
GETVGEELASLGISMNFAPVLDVNNNPENPVIGVRSFGDDPEAVGELGSALASGFQSAGV
IACGKHFPGHGDTETDSHRSLPVIPHDKDRLEAVEFVPFRRAIDDGIDALMTTHIAFPAI
TGDDTLPATLSKEVLTGLLREEFEFDGLLVSDCLEMNAIAETVGTAEGAVQAIAAGCDVV
LVSHSPERQREAIERVIDAVESGEIPEARVDSAFERVREYKHRQFTEEREKPQTWTETVE
QSREVARQLAREGATVVRDRDDTLPFDTSAPIHLVGFTGDAQSDAEDDRYDPNDFRTSLA
RNETKVYHHEVTDTHGYEHPFDGGEQVVVATYHARSNPGQARVVREIADAATRLAVVSVR
DPYDLAAVPDASTYVTGYGYSPAMLDALADVVVGKAGGDGTLPVTIPGVE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaacgtgttgacagcggagcgccccgtccatgcggtgccgctcgaagaaaag
gtcggacagttgtttgtggccggtttcgacggggtcgaaccgaccgacgacatcgaacag
ttagtgtcgtcgcaccatctcggtggcatcatctacttcagtcggaacatcgagtcaccg
tcgcaggtcgcgtcgctctcggaacgactccagaccatcgcgcgcgaagcgggcgagcca
ccactcctcattgcgacagaccaggaaggcggcgtcgtctcccggttcgactggggtgca
caactgcccagtcagatggcactcggggcgactcaggacccaacgagactccggtcagca
ggcgaaacagtcggcgaagaactcgcctcgctcggcatttcgatgaacttcgcgccggtt
ctggacgttaacaacaaccccgaaaacccggttatcggcgtacggtcgttcggggacgac
ccggaagccgtcggcgagttagggtcggcgctcgcgtcggggttccagtccgctggagtc
atcgcctgcgggaagcacttccccggacacggcgataccgagaccgattcgcatcggtcg
ctgccagtcattccacacgacaaagaccgactggaggccgtcgagttcgtcccgttccgc
cgcgccatcgacgacggtatcgacgcgctcatgacgactcacatcgctttcccggcgatt
acgggagacgacacgctcccggccacactttcgaaggaagtcctcaccggcctccttcgc
gaggagttcgaattcgacggactgctcgtctccgactgtctggagatgaacgctatcgct
gagacagtcggaacggccgaaggagcggtgcaagcgattgcagcaggttgtgacgtggta
ctcgtatcgcactcgcccgagcgccagcgagaggctatcgaacgggtcatcgacgccgtc
gagtccggtgagattcccgaggcgcgcgtcgacagcgcgttcgagcgggtgagagaatac
aagcaccgacagtttaccgaagagcgtgagaagccgcaaacgtggacggagacagtcgag
caatcgcgcgaggtcgcacgacaactcgcacgagagggagcgaccgtcgtccgcgaccgc
gacgacacactcccgttcgacacgtcagcacccatccacctcgtcggctttaccggtgac
gcccagtcggatgcggaagacgaccgatacgacccgaacgacttccgcacgtcgcttgct
cgaaacgagacgaaggtgtatcaccacgaggtcacagacacccacggatacgaacatcca
ttcgacgggggcgaacaagtcgtcgtcgcaacgtaccacgcacggtcgaatcccggacag
gcacgggtcgtccgcgagatagcggatgcagcgaccagactcgcagtcgtctcggtccgt
gacccctacgacctcgccgcagtaccagacgcttcgacgtacgttacgggctacggctac
tcaccggcaatgctggatgcactcgcggacgtggttgtcgggaaagcaggcggagacggg
acgctaccggtgacgattccgggtgtggaatga

DBGET integrated database retrieval system