KEGG   Haloferax mediterranei: HFX_5055Help
Entry
HFX_5055          CDS       T02129                                 

Gene name
hmcA
Definition
protporphyrin IX magnesium chelatase / magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HFX_5055 (hmcA)
Enzymes [BR:hme01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     HFX_5055 (hmcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM300:66727..68904
Genome map
AA seq 725 aa AA seqDB search
MTTQTLPFPAIVGQEELKRALLAVGVNDELDGLLVRGEKGTAKSTTVRALAELLPKQKVV
AGCPYGCPPDDPARQCESCRGRDDFDVETRPVPLVTLPLGATRDRVAGTLSVADALDGEA
SFDPGLLARANRGILYVDEVNLLDDHLVDLLLDTAASGVNRVERDGVSVEHPAEFTLVGT
MNPEEGDLRPQLRDRFALQASVVGSRSVDDRVTIIDRALERGHDSAESFDPYHDEVATLK
RDVRDARDRLATVSLPSDFKVDIAELCLDAGVEGHRADIAIARTARTLAALDGRTKVITG
DVREAAALALPHRLQNRPFDDAPDADDILDDHFDDEDQADGDTDEGDQQDDSTECEDSDA
GNEETDADSEENTGSEGDEEGESDEEGDTDSGGDDDSDRDPKQQPDSESSSDSENATDSG
GVETTRDGDSDDDHGDSPDSDSDSGSEPDDDDDEAPEATPLLPGQQRAAIGKTDEPPIDD
TDLQSDTPGGGTRVAVGESRHGRGSRVRTEPATTSDDIDVAASVRTAASNGRTSVTEADL
KTAVKRGSARSLIVFVVDASASMRSAMRETKGTVMSLLEDAYQQRDEVAFVAVAGDSAEV
LLPPTNSVTLAARHLKELPTGDRTPLPDGLDAAHRLVTRAETDSCLVVVVTDGRANVADG
SPTRETRSAARQLATSDASVVVVDAGDDGIGVTDILVSETNGQRISLSELSAERVVDAAK
SAREK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactacgcagacgctcccgttccctgcgattgttgggcaagaggagttgaaacgggcg
ttgctggccgttggcgtcaacgacgaactcgacgggcttctcgttcgtggcgagaagggg
acggcgaaatccacaaccgttcgggcactcgccgagttactgccaaagcagaaggtggtt
gcggggtgcccgtacgggtgcccgccggacgacccggcgcgacagtgcgaatcgtgccgc
gggcgcgatgacttcgacgtcgagacgcgtccagtcccgctcgtcaccctcccgctcggg
gcaactcgcgaccgcgttgccgggacgctctcggtcgccgacgcgctcgatggcgaagcg
tcgttcgaccccgggctgctcgcccgtgcgaaccgcggtattctctacgtcgacgaagtt
aatctgctggacgaccatctcgtcgacttgctcttggacaccgccgcgagcggcgtcaac
cgcgtcgaacgcgacggcgtcagcgtcgaacaccccgccgaattcacgctcgtcggcacg
atgaatcccgaagagggtgacctccgtccgcaactccgagaccgatttgccctccaagcg
agtgtcgtcggcagcaggtccgtcgacgaccgcgtcacgattatcgaccgggcgctcgaa
cgcggccacgactcggccgaatcgttcgacccgtaccacgacgaggtggccacgctcaaa
cgcgacgttcgagacgcccgcgaccgactggcgaccgtctctctcccttctgatttcaag
gtcgacatcgccgaactctgtctcgatgcgggcgtcgagggacacagagccgatatcgcc
atcgctcgcactgctcgaaccctcgccgcgctcgacggccgaacgaaagtcatcacgggc
gacgttcgcgaggccgcggcgctcgcgctcccgcaccgactccagaatcgcccgttcgac
gatgcccccgacgccgacgacatcctcgacgaccacttcgacgacgaagaccaagcggac
ggagacacagacgaaggcgaccagcaagacgatagcacggagtgtgaggattcggacgcg
ggaaacgaagagacagacgctgacagcgaggagaacactggcagcgaaggcgacgaagag
ggagaaagcgacgaagagggcgacaccgacagtggtggtgacgacgattccgaccgcgac
ccgaagcaacaacccgacagcgaatcctcgtccgacagcgagaacgcgaccgattcgggc
ggggtcgaaacgacgcgagacggtgacagcgacgacgaccacggggactcgccggactcg
gactccgattcggggtcggaacccgacgatgacgacgacgaagcgcccgaagcgacgccg
cttctccccggccagcaacgagcagcgattgggaagactgacgaaccacctatcgacgac
accgacctccagtctgacacacctggtggcggaacacgggtcgccgtcggtgaatcgcgg
cacggacgcgggtcgcgggtcaggaccgaacccgcgacgacctcggacgacatcgacgtt
gccgcatcggtccggacggccgcatcgaacggtcgaaccagcgtcaccgaggcggacctc
aaaacagccgtcaaacgaggctctgctcggtcgctcatcgtgtttgttgtcgacgcgagt
gcctcgatgcgctccgcgatgcgcgagacgaaagggaccgttatgtcgcttctcgaagac
gcctaccaacagcgagacgaagtcgcgttcgtcgccgtcgccggcgactcggccgaggtt
ctgctcccgccgaccaacagcgttacactcgcggcccggcacctgaaggaactccccacg
ggcgaccgaaccccgcttcccgacggcttggacgccgcccaccgactcgtcacgcgcgcc
gagacagactcgtgtctcgtcgtcgtcgtaaccgacggccgagcgaacgtcgccgacggc
agtccaacccgggagactcggtcggcggcgcggcaactcgcaaccagcgatgcatcggtc
gtcgtcgtcgacgccggagacgacggtatcggcgtgaccgacattctcgtctccgagacg
aacggacaacggatttcgctctccgaactctccgcagaacgagtggtcgacgccgcgaaa
tctgcccgcgagaaatag

DBGET integrated database retrieval system