KEGG   Haloferax mediterranei: HFX_5091Help
Entry
HFX_5091          CDS       T02129                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hme  Haloferax mediterranei
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:hme00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM300:complement(96781..98793)
Genome map
AA seq 670 aa AA seqDB search
MSHNTSTPDDESNESQQDPLSEYEAQLDAVLEKVDETAGEETDVSLELPTLGLSRRDFMK
AGAAVGAMGSIAGCTSLAGNDGAGGTTTPHSNSGDVPDHFVPPGEHDEYYGFWSGGHSGD
IRIYGLPSMRELTRIPVFNPEQAKGYGFDNQTTEMLESAGDYTWGDSHHPSLSETDGKYD
GKYLFVNDKAHGRVARVNLKYFETDAITNIPNVQSVHGCCIQSPDTEYVFANSEFRTPLP
NDGRDINNPDKYVSLFTALDPDSMEVLWQVEVDGNLDILDTDKDGRWAISSAYNDEEGVE
IEEMTKNDRDFVKAFDVPAIQKAVDAGNYKKVNGIPVVDGTKESSLNKGDNPIVRYVPTP
KSPHCVEVEPNGKYAMVAGKLSPTVSIIDIEKLGTASDPKDTIVGQPKLGLGPLHTTYDG
RGHAYTSLFIDSQVVKWDIETAINSPKKSEDAILGKIDVHYNPGHIQAIQAMSTEPTGDW
LVVLNKLSKDRFLPVGPIYPDNDQLIYIGNDKDDETGGMELVSDHPVYPEPHDAIFAAKD
KIQPAKTWDAADYEGEKEYVKESNSRVERIDEETVEVYTSVKRSEYGLRDFTVKEGDEVT
LTATNIEGSQDIVHGLAIPEHNVHLALAPQDTREATFTADKPGVYWIYCTYFCSALHLEM
RSRMIVEPRT
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacaacacatccacgccggacgacgaatccaacgaatcacagcaagacccgctt
tcggagtacgaagcacaactcgacgcggtcctcgagaaggtcgacgaaacagcaggagaa
gagacggatgtctcgctcgaactcccgacactcggattgagtcggcgcgacttcatgaaa
gcgggcgcggcggtcggtgccatgggttcgattgctggctgcaccagtctggcaggaaac
gacggtgctggcgggacaaccacgcctcattcgaactccggcgacgtgcccgaccacttc
gtgccgccgggtgaacacgacgaatactacggcttctggtccggcggccactccggggac
attcgaatctacggactgccgtcgatgcgcgaactcacccgaatcccggtgttcaacccg
gaacaagcgaagggctacgggttcgacaaccagacgaccgagatgctcgaatccgcgggc
gactacacgtggggcgactcccaccacccgagtctctccgagacggacgggaagtacgac
gggaagtacctgttcgtgaacgacaaggctcacggccgggtcgcgcgggtgaacctgaaa
tacttcgagacggacgcgattaccaacattccgaacgttcagtcggtccacgggtgctgt
atccagagccccgacaccgagtacgtctttgcgaacagcgagttccggacgccactgccg
aacgacggacgagacatcaacaacccagacaaatacgtctcgctgtttaccgccctcgac
cccgactcgatggaagtgctctggcaggtcgaagtggacggcaacctcgacatcctcgac
acggacaaggacggccggtgggcgatttcgagcgcctacaacgacgaagagggtgtcgaa
atcgaggagatgacgaagaacgaccgcgacttcgtcaaggcgttcgacgtgccggcgatt
cagaaggcggtcgacgcgggcaactacaagaaggtaaacgggattccggtcgtcgatggg
acgaaagaaagctcactcaacaagggcgacaacccgattgtccggtacgtcccgacaccc
aagtcgccacactgtgtcgaagtcgagccgaacggcaagtacgcgatggtcgccggaaag
ctctcgccgacggtgtccatcatcgacatcgaaaaactcggcacggcgtccgacccgaaa
gataccatcgtcggccagccgaaactcggtctcggcccgcttcacaccacctacgacggt
cgtgggcacgcgtacacgtcactgttcatcgactcgcaggtcgtcaagtgggacatcgaa
accgcgattaactcgccgaagaagtccgaagacgccatcctcgggaagatagacgtgcac
tacaatcccggtcacattcaggcgattcaggcgatgtcgaccgagccgaccggcgactgg
ctcgtcgtcctgaacaagctctcgaaagaccggttcctcccggtcgggccaatctacccc
gacaacgaccagctcatctacatcggcaacgacaaggacgacgagaccggtggaatggaa
ctcgtctcggaccacccggtgtaccccgaaccgcacgacgcaatcttcgcggcgaaagac
aagattcagccggcgaagacgtgggatgccgcggattacgagggcgaaaaggagtacgtc
aaagaaagcaactcgcgcgtcgaacgcatcgacgaggaaaccgtcgaggtgtacacgtcg
gtcaagcgcagtgagtacggactccgtgacttcacggtcaaagaaggcgacgaggtcact
ctcaccgccacgaacattgaaggaagccaagacatcgtccacggactcgccattcccgag
cacaacgtgcacctcgcactcgcgccgcaggacacccgcgaagccacgttcacggctgat
aagcctggtgtgtactggatctactgtacgtacttctgcagcgcgctccacctcgagatg
cgctcgcggatgattgtcgaaccgagaacctag

DBGET integrated database retrieval system