KEGG   Haloferax mediterranei: HFX_5131Help
Entry
HFX_5131          CDS       T02129                                 

Gene name
acs
Definition
(RefSeq) acyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hme  Haloferax mediterranei
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFX_5131 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFX_5131 (acs)
   00620 Pyruvate metabolism
    HFX_5131 (acs)
   00640 Propanoate metabolism
    HFX_5131 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HFX_5131 (acs)
   00680 Methane metabolism
    HFX_5131 (acs)
Enzymes [BR:hme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HFX_5131 (acs)
Lipid biosynthesis proteins [BR:hme01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HFX_5131 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM300:144492..146486
Genome map
AA seq 664 aa AA seqDB search
MADGDIELEARLEEQAEFEPSAEFVAQANVSDPSIYEEFEENWPECWERAADLLDWDGDY
DEVLDDSNPPFYEWFTGGKLNASSNCVDRHVENGDKNRVAIKWEGELGETRTYTYQDLYR
EVNEFAAALRAQGVEEDDVVTLYMPMIPELPIAMLACARIGAPHSVVFAGFSAEALATRM
NSADSRYLVTCDGYYRRGDALDHLDKANEGLDGVDHGVESVVVVDRLGDDGFGHDLKGNQ
HDWSALMDEHDGERVAPVERDAEDMLFLMYTSGTTGQPKGVKHTTGGYLSYAAWTSHAVL
DIEPEDTYWCSADIGWITGHSYIVYGPLALGTTTVMYEGTPDYPTCDRLWETVEKYAVDI
FYTAPTAIRAFMKWGKKFPESRDLSSLRLLGTVGEPINPRAWKWYHKYIGNEDCPIVDTW
WQTETGGMMITTLPGIGTMKPGAAGPPLPGVDAQIVDTNGEEVQPGRAGYLTVNKPWPGM
LRTLYKNDERYISEYWREYSDTDSDDPDDWVYFPEDGAKIDEDGYITILGRVDDVINVSG
HRLGTMEIESAIVGVEGVAEAAVVGGDHEIKGEAVYAYVITEDGYEGDEDLRERIIEGVN
DGIGPIARPEKVVFTPELPKTRSGKIMRRLLEDVANGDELGNTSTLRNPEIVEEIEAKVH
AQSD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcagatggtgacattgaactggaggcgcggctggaagaacaggcggaattcgaaccc
tctgcagagttcgtcgcgcaggcgaacgtgtcggacccctcgatttacgaggagttcgag
gagaactggcccgagtgctgggagcgggccgccgacctgcttgactgggacggcgactac
gatgaggtactcgatgactcgaacccgccgttctacgagtggttcaccgggggcaagcta
aacgcctcctccaactgtgtcgaccggcacgtcgagaacggtgacaagaaccgggtggca
atcaagtgggagggtgaactcggcgagacgcggacctacacgtatcaggacctctaccgc
gaagtaaacgagttcgcggccgcacttcgcgcacagggcgtcgaggaagacgacgtggtg
accctctacatgccgatgattccggagttgcccatcgccatgctcgcgtgcgcccgcatt
ggcgcgccccactcggtcgtctttgctgggttctctgccgaggcgctcgcgacgcggatg
aactccgctgactcccggtatctcgtcacttgtgacggctactaccgccgcggcgacgca
ctcgaccacctcgacaaggcgaacgagggtctcgatggcgtcgaccacggcgtcgaatcg
gtcgtcgtggtcgaccgactgggtgacgacgggttcgggcacgacctgaagggtaaccag
cacgactggagcgcgttgatggacgagcacgacggcgagcgcgtcgcccctgtcgagcgc
gacgccgaagacatgctctttttgatgtacacgtcgggaacgaccggccagcccaaaggt
gtcaaacacaccactggcgggtacctctcgtacgcggcgtggacctcgcacgcggtgctc
gatatcgaacccgaggacacctactggtgctctgcggacatcggctggattaccggtcac
tcctacatcgtctacggcccactcgcgctcggcaccacgaccgtcatgtacgagggaaca
cccgattaccccacgtgcgaccgtctgtgggaaaccgtcgagaaatacgccgtcgatatc
ttctacacggctccgacggcgattcgcgcgttcatgaagtggggtaagaagttccccgag
tcgcgcgacctgtcgtcgctccgcctgctcgggacggttggcgaacccatcaacccgcgc
gcgtggaagtggtatcacaagtacatcggcaacgaggactgccccatcgtcgatacgtgg
tggcagacagagacaggtgggatgatgattacgacccttccgggaatcggcacgatgaaa
cccggggcggccggtccgccacttcccggcgtcgacgcccaaatcgtcgacacgaacggt
gaggaagtacaacccgggcgcgcgggctaccttacggtgaacaagccgtggcccggaatg
ctccggacgctgtacaaaaacgacgagcgctacatctccgagtactggcgggagtactcc
gacaccgacagcgacgaccctgacgactgggtgtacttccccgaggacggcgcgaaaatc
gacgaggacggctatatcaccatcctcggccgggtcgacgacgtgattaacgtctccggc
caccgtctcgggacgatggaaatcgagtccgccatcgtcggcgtcgaaggcgtcgccgaa
gcggcggtcgtcggcggcgaccacgaaatcaagggagaggctgtttacgcctacgtcatc
accgaagacggctacgagggcgacgaggaccttcgcgagcgtatcatcgaaggcgtcaac
gacggcatcggcccaatcgcccgccccgagaaagtcgtcttcacgcccgaactgccgaag
acgcgctcggggaaaatcatgcgacgcctgctcgaagacgtggcgaacggagacgaactc
gggaacacctcgacgctccggaaccccgaaatcgtcgaggagatcgaagcgaaggtccac
gcacagagcgactga

DBGET integrated database retrieval system