KEGG   Haloferax mediterranei: HFX_6346Help
Entry
HFX_6346          CDS       T02129                                 

Gene name
trpB_2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hme  Haloferax mediterranei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hme01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hme00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hme00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM500:370228..371379
Genome map
AA seq 383 aa AA seqDB search
MTHGDFDGYGGRYVPEALESALKQLATAYDDISASDDFQAEFRGLLETYAGRATPLYHAR
NLSERYGADIYLKREDLLHGGAHKINNALGQALLAKKAGKDRLIAETGAGQHGTATAMVG
ALFNLDTEIYMGKKDVERQQMNVFRMRLMGAEVNEVTRGGSGLADAVDAALEDFAKNIDE
THYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFLDRTGELPDAAVACVGGGSNAIGLFHA
FRDDNVSFYGAEGGGKGPDSKQHAAPLAKGKDDVIHGMKTRVIDDDVEVHSVSAGLDYPG
VGPEHAMFRALGRAEYTGVTDDEALAAFRELSETEGIIPALESSHAVARAIQLAETSEHD
TILVNLSGRGDKDMETAAERFSL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacggagatttcgacggatacggcgggcgatacgtccccgaagcactcgaatcg
gcacttaaacagctcgcgacggcttacgacgacatctcggcgtcggacgacttccaggcc
gagttccgtggcttgctcgaaacgtacgcgggacgcgcaacaccgttgtaccatgcacgg
aacctgagcgagcgatacggtgcggacatctacctcaaacgcgaggacctgctccacggc
ggcgcgcacaaaatcaacaacgcactcggacaggcgctcttggcgaagaaagccggtaag
gaccgactcatcgccgaaacaggtgccggacaacacggcacggcaactgcgatggtgggt
gcgctgttcaacctcgacacggagatttacatggggaaaaaggacgtcgagcgccagcag
atgaacgtcttccgtatgcgcctgatgggggccgaagtgaacgaggtaactcgcggcggg
tccggactcgccgacgccgtcgacgccgcgttagaggacttcgcgaagaatatcgacgag
acgcactacctcgtcggaagcgtcgtcggcccggaccccttcccgcggatggttcgggac
ttccagagcgtcatcggtgaggaggcgcgcgagcagttcctcgaccggacgggcgaactc
cccgacgccgccgttgcgtgtgtcggcggcgggtcgaacgccatcggcctcttccacgcc
ttccgcgacgataacgtgtcgttctacggggctgaaggaggcggtaaggggcccgactcg
aagcaacacgctgcaccccttgcgaaggggaaagacgacgttatccacgggatgaaaacc
cgcgtcatcgacgacgacgtggaagttcactcggtctccgccgggttggattaccccggt
gtcggcccggaacacgcgatgttccgcgcgctcggccgtgctgagtacaccggcgtcacc
gacgacgaggcgctcgcggcgttccgcgaactcagcgagaccgaaggcatcattccggcg
ctcgaatccagtcacgccgtcgcgcgagcgattcaactcgcggaaacaagcgaacacgac
accatcctcgtcaacctctccggacgcggtgacaaggacatggagaccgcggcggagcga
ttcagcctctaa

DBGET integrated database retrieval system