KEGG   Haloferax mediterranei: HFX_6346Help
Entry
HFX_6346          CDS       T02129                                 

Gene name
trpB_2
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hme  Haloferax mediterranei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HFX_6346 (trpB_2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HFX_6346 (trpB_2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HFX_6346 (trpB_2)
Enzymes [BR:hme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HFX_6346 (trpB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM500:370228..371379
Genome map
AA seq 383 aa AA seqDB search
MTHGDFDGYGGRYVPEALESALKQLATAYDDISASDDFQAEFRGLLETYAGRATPLYHAR
NLSERYGADIYLKREDLLHGGAHKINNALGQALLAKKAGKDRLIAETGAGQHGTATAMVG
ALFNLDTEIYMGKKDVERQQMNVFRMRLMGAEVNEVTRGGSGLADAVDAALEDFAKNIDE
THYLVGSVVGPDPFPRMVRDFQSVIGEEAREQFLDRTGELPDAAVACVGGGSNAIGLFHA
FRDDNVSFYGAEGGGKGPDSKQHAAPLAKGKDDVIHGMKTRVIDDDVEVHSVSAGLDYPG
VGPEHAMFRALGRAEYTGVTDDEALAAFRELSETEGIIPALESSHAVARAIQLAETSEHD
TILVNLSGRGDKDMETAAERFSL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacggagatttcgacggatacggcgggcgatacgtccccgaagcactcgaatcg
gcacttaaacagctcgcgacggcttacgacgacatctcggcgtcggacgacttccaggcc
gagttccgtggcttgctcgaaacgtacgcgggacgcgcaacaccgttgtaccatgcacgg
aacctgagcgagcgatacggtgcggacatctacctcaaacgcgaggacctgctccacggc
ggcgcgcacaaaatcaacaacgcactcggacaggcgctcttggcgaagaaagccggtaag
gaccgactcatcgccgaaacaggtgccggacaacacggcacggcaactgcgatggtgggt
gcgctgttcaacctcgacacggagatttacatggggaaaaaggacgtcgagcgccagcag
atgaacgtcttccgtatgcgcctgatgggggccgaagtgaacgaggtaactcgcggcggg
tccggactcgccgacgccgtcgacgccgcgttagaggacttcgcgaagaatatcgacgag
acgcactacctcgtcggaagcgtcgtcggcccggaccccttcccgcggatggttcgggac
ttccagagcgtcatcggtgaggaggcgcgcgagcagttcctcgaccggacgggcgaactc
cccgacgccgccgttgcgtgtgtcggcggcgggtcgaacgccatcggcctcttccacgcc
ttccgcgacgataacgtgtcgttctacggggctgaaggaggcggtaaggggcccgactcg
aagcaacacgctgcaccccttgcgaaggggaaagacgacgttatccacgggatgaaaacc
cgcgtcatcgacgacgacgtggaagttcactcggtctccgccgggttggattaccccggt
gtcggcccggaacacgcgatgttccgcgcgctcggccgtgctgagtacaccggcgtcacc
gacgacgaggcgctcgcggcgttccgcgaactcagcgagaccgaaggcatcattccggcg
ctcgaatccagtcacgccgtcgcgcgagcgattcaactcgcggaaacaagcgaacacgac
accatcctcgtcaacctctccggacgcggtgacaaggacatggagaccgcggcggagcga
ttcagcctctaa

DBGET integrated database retrieval system