KEGG   Haloferax mediterranei: HFX_6463Help
Entry
HFX_6463          CDS       T02129                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hme  Haloferax mediterranei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:hme00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:hme00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHM500:472083..472946
Genome map
AA seq 287 aa AA seqDB search
MSSEAFDLTEPELTADDLLVLDDPHFGPETTAVVTGAASGIGQATAVALAANGISVIGAD
IDEEGLEETIDIAADVDASGTVHPVTTDLTDDADVETMVEAAAEHGELRYVANIAGMQHI
ASIPEFPMEKYDLLLDVMLRAPFLTAKHAMPHIRETDDGAGAIGNMSSVHGHYATQDKPA
YITAKHGLEGLTRAIAAEGEGTLRGFSVSVGYVLTPLMVNQIEDTAEERGISKREVVEDV
MLGQARTKEMMTPAEVANLFVFGFSSHGKHLNGGDLLWDGGYTTTYE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccgaagcgttcgatctcaccgagccagaactaaccgccgacgacctgcttgtt
ctcgacgacccacacttcggtcccgaaaccacggccgtcgtgacgggggctgcatcgggt
attggtcaggcgactgcggttgccttggccgcgaatggaatctcggttatcggtgccgac
atcgacgaggagggtctcgaagagacaatcgacatcgctgctgacgtcgacgcgtcaggc
acggtccatccagtgaccaccgacctcactgacgacgctgacgtcgagacgatggtcgag
gctgcggccgagcacggagagctcagatacgtcgcaaacatcgccggaatgcaacacatc
gcgtcgattccggagttcccaatggagaagtacgacctccttctggacgttatgttgcgc
gcaccgtttctaacagcgaagcacgcgatgccgcacatccgtgagacggacgacggtgcc
ggtgccatcggcaacatgtcttcggtgcacggtcactacgcgacccaagacaagcccgcg
tacatcactgcgaagcacggtctcgagggactcacccgagccatcgctgccgagggcgag
gggacgcttcgaggcttttcagtcagcgtcgggtacgtcctcaccccgttgatggtaaat
caaatcgaagacacggccgaggagcgaggtatctccaaacgggaggtcgtcgaggacgta
atgctcggacaggcccgcaccaaggagatgatgacacccgccgaggttgcaaacctcttc
gtgttcgggttctccagccacggcaagcatctcaacggcggcgacttgctctgggatggg
gggtacacgacgacctatgagtaa

DBGET integrated database retrieval system