KEGG   Hydra vulgaris: 100196975Help
Entry
100196975         CDS       T01080                                 

Gene name
sos2
Definition
(RefSeq) son of sevenless homolog 2
  KO
K03099  
son of sevenless
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100196975 (sos2)
   04150 mTOR signaling pathway
    100196975 (sos2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100196975 (sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1217 aa AA seqDB search
MHDKDKLDTSKWRNMIVTSLKKVQKQVQPTLTVDTDALLYLEELIFKLLYQLCSVQPHSV
HDIQEQINKTFPCQIKGWALESAEAAIEKGKKKTLKLSVDKLQPVIQKEILGYKIDIQLA
IYIVAVLEYISADILKLAGNYVKNIRQMVINKQDVKVAMNADKVLASMFNSEDIDNLIET
QPLAKRRSLTYIDVLKDFMLCEEQFIRELNLIVKVFRKKMVCASHLFSQQDLNEIFCNIM
EIYEFTTQFYDLIESTLEMSENDLLIGDLFEEMVEAAEFECYDTYTYGNVVSPTGGSYYI
IKTLMYRPGVADFFKEQGIFDAVRYILPKLLYGPIHHCIDYFEYIKILMCTSPDGNDREK
LGESLSALRGLQVRIEKLCSASHLKRTPENEVFYERHIGVNETNTMAKIECIQENLEGWE
GKPLCQVVSVLLKEGFLTRIGKKASERKIFLFDNLMLCAKVNKHNITGFNQTEFRLKEHI
YLRKVEVRDITDDDKQFSFEILQPGEPAAVFSCKDEKSKYEWLSLLMALNHRSTLDRMLD
ALLQEETQSIQLKTPDPSIYIFAEEDSEKNILFENIEDDSAVIKGGTLPKLIERLTYHKH
ADPTFVRVFLTTYRSFSNPVELLDLLIKRYDIPEPITDLSNKQVFNKEDLKKFRKEYVQP
IQLRVLNVLRHWVDQHFYDFQREETLLITLEKFLSRVVRSKTARKWVESIEKIVNRRLEM
VKVDPETYSFNTPPPPIEWHLTQDFDKFTILTLHPLEIGRQLTIMQSQIFRAIRPSELVG
TVWTKKEKEKLSPNTLKLIRLSTLLTYWYELNIVEAHNFEERVAVYTRIIDILMVFLSLN
NFNGMMEILGALNSAPVFRLQHLKAVELSPKRLQALQEAKDLTDDGHNVKYMEKLRSINP
PCVPFLGVYLSNILRAEEGNPDYLSSSPEGLINFSKRRMVADITGEIQKYQNMPYNLQVE
PSIRAYLESLDPLAGRSDSELNDHLYEMSLMIEPRNAKQPAKFIRKTDIPLKSPGIKPGQ
RSLINYRKSTSVSELDQHLPSRHLPSPTHSVSAFSFVVNGDVTDGKAEKEKKENISLPPP
LLLPRAPLANEIPPEIPTKPNTLKQVNQPPDITKQQPLPRQPRRSISIQECILPPALPPR
TKTIGEKTISFSSEYKNYVFPPQTPCRSEIIDNDIAVSNPAPIIPPRINQEFVRRQSEDF
NTSTQLPQIPPKVSNKR
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgcacgataaagataagttagatacctccaaatggagaaatatgatcgttacgtccttg
aaaaaggtacaaaagcaagttcaaccaacacttacagtggatacagatgcacttttatat
cttgaagagctaatttttaaattattgtaccagttgtgcagtgttcagccacactctgtt
catgatattcaagaacaaataaataaaacatttccttgtcaaattaaaggctgggcatta
gaatctgcggaagcagcaattgaaaaaggaaagaaaaaaactctaaagttatcagttgat
aaacttcaacctgttattcaaaaggaaattcttggctacaagatcgatattcagttggca
atatatatagttgcagttttagaatacatatctgcagacattctaaagctggctggaaat
tatgtaaaaaacatcagacaaatggtgattaataaacaagatgttaaagttgctatgaat
gcagataaggttttggcatcaatgtttaacagtgaggatattgataatctaattgagaca
cagccactagctaagcgtcgttcactaacctacattgatgttttaaaagacttcatgcta
tgtgaggaacagtttataagagaacttaaccttattgttaaggtttttcgtaaaaaaatg
gtttgtgcctcgcatctattttcacaacaggaccttaacgaaatattctgcaatataatg
gagatttatgaatttacaacacaattttatgatttgatcgaatcaacactggagatgtca
gagaatgacctacttattggtgatttattcgaagaaatggttgaggcagctgaatttgaa
tgctatgatacttacacttatggtaatgttgtatcacctactggtggatcatactatatt
atcaaaactttaatgtaccgacctggtgttgcagatttttttaaggagcaaggtattttt
gatgcagtaagatatatattacctaagttactttatggcccgattcatcattgcattgat
tatttcgaatatattaagattctcatgtgtacatcccctgatggaaatgacagagagaaa
cttggagagtctctaagtgctttgcgtggactgcaggttaggattgaaaagttgtgctca
gcatctcacctcaaaagaactccagagaatgaagtgttttatgaacgtcacattggggta
aatgagacaaatactatggccaaaattgaatgtattcaagaaaacttggagggatgggaa
ggcaaaccattatgtcaagtagtatcagttcttctaaaggagggatttttaactagaatt
ggtaaaaaggcatctgagcgtaaaatatttctttttgataacctgatgttatgtgccaaa
gtgaacaaacacaatatcacaggttttaatcaaactgaatttcgattaaaagaacatata
taccttagaaaggttgaagttagggatattactgatgatgataagcagttttcatttgaa
atattgcaaccaggtgaaccagcagctgttttttcttgcaaagatgaaaagtcaaaatat
gaatggttatcacttcttatggcattaaatcacagaagtactttggatcgcatgctagac
gctttattgcaagaggaaacacagagtatacaattaaaaaccccggacccatcgatatac
atattcgcagaggaagattcagaaaagaatatattgtttgaaaatattgaagatgacagc
gctgttattaaaggtggaacgcttcctaaactaatagaaagacttacataccataaacat
gccgatccaacatttgtgagagttttccttaccacttacagatcgtttagcaatcccgta
gagcttcttgatctacttataaaacggtatgatattcctgaaccaatcactgatttgagc
aacaagcaggtttttaataaagaagatcttaaaaagtttagaaaagaatatgttcaaccg
atacaattaagagtgttgaacgtgttgcgtcattgggtggaccagcatttttacgatttt
cagagagaagaaacgctgttaattactttagaaaagtttttatcgcgtgttgtacgtagc
aaaaccgcgagaaaatgggtagaatcaattgaaaagattgtaaatagaaggttggaaatg
gtaaaagttgatcctgaaacgtattcttttaacacgccgccgcctccgattgaatggcat
ttgacacaagattttgataaatttactatattaactttgcatcccttagagattggcagg
caattaaccataatgcaatcgcaaatatttagagcgattcgtccgtcagaattggtggga
acggtgtggacaaaaaaagaaaaagaaaagctttctccaaacacactcaagttaattcga
ctgtctacattacttacttactggtatgagttaaacattgttgaagcccataactttgaa
gaaagagtggcagtctatacgagaattattgatatattaatggttttcctttctttaaac
aatttcaatggaatgatggaaatactaggtgcattaaattctgctccggtatttcgcctt
cagcatttgaaagctgtggaattatcgccaaaacgattacaagctttacaagaagctaag
gatcttaccgatgacggtcacaatgtgaaatatatggaaaagctgcgttctattaatcca
ccttgtgttccatttttaggagtttatttgtcaaacatcttacgtgctgaagaaggcaat
ccagactatttgagcagttcacctgaagggctaataaattttagtaaaagacgaatggta
gcggatattacaggcgaaatacagaaatatcaaaatatgccttacaatctgcaagttgaa
ccttctataagagcatacttagaatcacttgaccctttagctggtcgttcagatagtgaa
ctgaatgatcatctttacgagatgtcacttatgattgagccgagaaatgcaaaacaaccg
gctaagtttatacgaaaaaccgatattccgcttaaatcacctggaataaaacccggtcag
cgcagtctaattaattatcgaaaatctacatctgtttcagagttagatcaacatttacct
tctcgtcatttgccttctccaactcactctgtctcggcattttcatttgtcgttaatgga
gatgtgacggatggcaaagcagaaaaagaaaaaaaagaaaatatttccttacctccacct
ttgctcttgcctcgtgctcctttagccaacgagattcctccggaaattccgacaaaacct
aatacactaaaacaagttaatcaaccaccggatattacaaaacagcaacctttgcctcgc
cagccacgtcgatcaatctctatacaagaatgtattttgccacctgcactacctccaaga
actaaaaccataggtgaaaaaactatttcattttcttccgaatacaagaactatgttttc
cctcctcaaactccttgcagaagtgaaattattgataatgatatcgcggtttctaatcca
gctccgattattccgccacgtattaatcaagaatttgttcgtcgccaatctgaagacttt
aatacttcaactcagctgccgcaaattcctccaaaagttagcaataagaggtga

DBGET integrated database retrieval system