KEGG   Hydra vulgaris: 100196975Help
Entry
100196975         CDS       T01080                                 

Gene name
sos2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100196975 (sos2)
   04068 FoxO signaling pathway
    100196975 (sos2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    100196975 (sos2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 812 aa AA seqDB search
MAKIECIQENLEGWEGKPLCQVVSVLLKEGFLTRIGKKASERKIFLFDNLMLCAKVNKHN
ITGFNQTEFRLKEHIYLRKVEVRDITDDDKQFSFEILQPGEPAAVFSCKDEKSKYEWLSL
LMALNHRSTLDRMLDALLQEETQSIQLKTPDPSIYIFAEEDSEKNILFENIEDDSAVIKG
GTLPKLIERLTYHKHADPTFVRVFLTTYRSFSNPVELLDLLIKRYDIPEPITDLSNKQVF
NKEDLKKFRKEYVQPIQLRVLNVLRHWVDQHFYDFQREETLLITLEKFLSRVVRSKTARK
WVESIEKIVNRRLEMVKVDPETYSFNTPPPPIEWHLTQDFDKFTILTLHPLEIGRQLTIM
QSQIFRAIRPSELVGTVWTKKEKEKLSPNTLKLIRLSTLLTYWYELNIVEAHNFEERVAV
YTRIIDILMVFLSLNNFNGMMEILGALNSAPVFRLQHLKAVELSPKRLQALQEAKDLTDD
GHNVKYMEKLRSINPPCVPFLGVYLSNILRAEEGNPDYLSSSPEGLINFSKRRMVADITG
EIQKYQNMPYNLQVEPSIRAYLESLDPLAGRSDSELNDHLYEMSLMIEPRNAKQPAKFIR
KTDIPLKSPGIKPGQRSLINYRKSTSVSELDQHLPSRHLPSPTHSVSAFSFVVNGDVTDG
KAEKEKKENISLPPPLLLPRAPLANEIPPEIPTKPNTLKQVNQPPDITKQQPLPRQPRRS
ISIQECILPPALPPRTKTIGEKTISFSSEYKNYVFPPQTPCRSEIIDNDIAVSNPAPIIP
PRINQEFVRRQSEDFNTSTQLPQIPPKVSNKR
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaattgaatgtattcaagaaaacttggagggatgggaaggcaaaccattatgt
caagtagtatcagttcttctaaaggagggatttttaactagaattggtaaaaaggcatct
gagcgtaaaatatttctttttgataacctgatgttatgtgccaaagtgaacaaacacaat
atcacaggttttaatcaaactgaatttcgattaaaagaacatatataccttagaaaggtt
gaagttagggatattactgatgatgataagcagttttcatttgaaatattgcaaccaggt
gaaccagcagctgttttttcttgcaaagatgaaaagtcaaaatatgaatggttatcactt
cttatggcattaaatcacagaagtactttggatcgcatgctagacgctttattgcaagag
gaaacacagagtatacaattaaaaaccccggacccatcgatatacatattcgcagaggaa
gattcagaaaagaatatattgtttgaaaatattgaagatgacagcgctgttattaaaggt
ggaacgcttcctaaactaatagaaagacttacataccataaacatgccgatccaacattt
gtgagagttttccttaccacttacagatcgtttagcaatcccgtagagcttcttgatcta
cttataaaacggtatgatattcctgaaccaatcactgatttgagcaacaagcaggttttt
aataaagaagatcttaaaaagtttagaaaagaatatgttcaaccgatacaattaagagtg
ttgaacgtgttgcgtcattgggtggaccagcatttttacgattttcagagagaagaaacg
ctgttaattactttagaaaagtttttatcgcgtgttgtacgtagcaaaaccgcgagaaaa
tgggtagaatcaattgaaaagattgtaaatagaaggttggaaatggtaaaagttgatcct
gaaacgtattcttttaacacgccgccgcctccgattgaatggcatttgacacaagatttt
gataaatttactatattaactttgcatcccttagagattggcaggcaattaaccataatg
caatcgcaaatatttagagcgattcgtccgtcagaattggtgggaacggtgtggacaaaa
aaagaaaaagaaaagctttctccaaacacactcaagttaattcgactgtctacattactt
acttactggtatgagttaaacattgttgaagcccataactttgaagaaagagtggcagtc
tatacgagaattattgatatattaatggttttcctttctttaaacaatttcaatggaatg
atggaaatactaggtgcattaaattctgctccggtatttcgccttcagcatttgaaagct
gtggaattatcgccaaaacgattacaagctttacaagaagctaaggatcttaccgatgac
ggtcacaatgtgaaatatatggaaaagctgcgttctattaatccaccttgtgttccattt
ttaggagtttatttgtcaaacatcttacgtgctgaagaaggcaatccagactatttgagc
agttcacctgaagggctaataaattttagtaaaagacgaatggtagcggatattacaggc
gaaatacagaaatatcaaaatatgccttacaatctgcaagttgaaccttctataagagca
tacttagaatcacttgaccctttagctggtcgttcagatagtgaactgaatgatcatctt
tacgagatgtcacttatgattgagccgagaaatgcaaaacaaccggctaagtttatacga
aaaaccgatattccgcttaaatcacctggaataaaacccggtcagcgcagtctaattaat
tatcgaaaatctacatctgtttcagagttagatcaacatttaccttctcgtcatttgcct
tctccaactcactctgtctcggcattttcatttgtcgttaatggagatgtgacggatggc
aaagcagaaaaagaaaaaaaagaaaatatttccttacctccacctttgctcttgcctcgt
gctcctttagccaacgagattcctccggaaattccgacaaaacctaatacactaaaacaa
gttaatcaaccaccggatattacaaaacagcaacctttgcctcgccagccacgtcgatca
atctctatacaagaatgtattttgccacctgcactacctccaagaactaaaaccataggt
gaaaaaactatttcattttcttccgaatacaagaactatgttttccctcctcaaactcct
tgcagaagtgaaattattgataatgatatcgcggtttctaatccagctccgattattccg
ccacgtattaatcaagaatttgttcgtcgccaatctgaagactttaatacttcaactcag
ctgccgcaaattcctccaaaagttagcaataagaggtga

DBGET integrated database retrieval system