KEGG   Hydra vulgaris: 100197103Help
Entry
100197103         CDS       T01080                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
hmg  Hydra vulgaris
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 436 aa AA seqDB search
MPEKCSRFSDVNINSFCELGACRTNCKKNVNCFSQLGEKFWFSDIKETYWVSPIDSESER
RIKGNHVGLKNLGATCYVNTILQLSFHNKAFRSAIYQWKFSDGFVPKLIVKDSNADASKS
LLLEFDDNQTNKICGNLQYLFALLELSNRRYVDPSSFVECLGLQTNEQQDAQEFSKLFIT
LLNNAFSSQDGFLSNIIHSQFGGQYKYETKCNVCLNKSVTCSDFYELDLNVKGHSSLHGC
LKEFLQEEIMEGENQYFCSICCCKQNALRKIVLEKLPPVLKLNLLRFVFERETGTKKKIN
TALNFPETIDMGKYIKFDNPEDGLYHLSSVLIHRGLSAHSGHYIAHIYDEENNIWCRFND
EEVTIMKGKTLQLGVEDNLEDFGETKSKKPRKCDQDTKNHNSKNAYMLVYTKTVGYVKIH
SIFIFIFKEEGPNNPF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaatgttcccgattttctgatgtaaatattaattctttttgtgaactcgga
gcatgcagaacaaactgtaaaaaaaatgtcaactgtttctctcaattgggcgaaaaattt
tggtttagtgatattaaagagacttattgggttagccccattgatagtgagtcagaaaga
agaataaagggaaatcatgtaggattaaaaaatcttggagccacttgttatgttaacaca
attttgcagctttcatttcataataaagcatttcgttctgcaatatatcaatggaaattt
tctgacggttttgtacctaagttgatagtcaaagacagtaatgcagatgcatctaaatct
cttctattagaatttgatgacaatcaaaccaataaaatttgtggaaaccttcaatatttg
tttgcattacttgaattaagtaatagaagatatgtagatccttcatcttttgttgaatgt
cttggattacaaacaaatgaacagcaagatgctcaggagtttagcaaactttttattaca
cttcttaataatgcattttcttctcaagatggttttctttctaatataattcattcacag
tttggtggacaatataagtatgaaactaaatgtaatgtgtgtctgaacaaatcagtcaca
tgctcagatttttatgagcttgatttaaatgttaaaggtcatagttcattgcatggttgt
ttaaaagaattcttgcaagaagaaatcatggaaggtgaaaaccaatatttttgttctatt
tgttgctgcaagcaaaatgctttacgtaaaattgtattggaaaaattgccacctgttttg
aagctaaatcttcttcgatttgtgtttgaaagagaaactggaacaaagaaaaaaattaat
acagctcttaatttccctgaaactattgacatggggaagtacataaagtttgacaatcct
gaagatgggctctatcatttgtcttctgtgttgattcatcggggacttagtgcacattct
ggtcattacattgctcatatctatgatgaagagaataatatatggtgtcgttttaatgat
gaagaggttaccataatgaagggaaaaacattgcaacttggggttgaagataatttagaa
gattttggtgaaacgaaaagtaagaaacctcgaaagtgtgaccaagatacaaaaaatcac
aattctaaaaatgcttacatgcttgtgtacaccaagactgttggttatgtaaagattcac
agcattttcattttcatcttcaaagaagaagggcccaataaccctttctga

DBGET integrated database retrieval system