KEGG   Hydra vulgaris: 100197103Help
Entry
100197103         CDS       T01080                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 48-like
  KO
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100197103
Peptidases [BR:hmg01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100197103
Ubiquitin system [BR:hmg04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100197103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 599 aa AA seqDB search
MPEKCSRFSDVNINSFCELGACRTNCKKNVNCFSQLGEKFWFSDIKETYWVSPIDSESER
RIKGNHVGLKNLGATCYVNTILQLSFHNKAFRSAIYQWKFSDGFVPKLIVKDSNADASKS
LLLEFDDNQTNKICGNLQYLFALLELSNRRYVDPSSFVECLGLQTNEQQDAQEFSKLFIT
LLNNAFSSQDGFLSNIIHSQFGGQYKYETKCNVCLNKSVTCSDFYELDLNVKGHSSLHGC
LKEFLQEEIMEGENQYFCSICCCKQNALRKIVLEKLPPVLKLNLLRFVFERETGTKKKIN
TALNFPETIDMGKYIKFDNPEDGLYHLSSVLIHRGLSAHSGHYIAHIYDEENNIWCRFND
EEVTIMKGKTLQLGVEDNLEDFGETKSKKPRKCDQDTKNHNSKNAYMLVYTKTVGCLDRT
GVAVSLENGKSYWVGKKSLKKIKLLAQQEFVKCKTSVCQANEETIGKINVEIHGKSKIEN
FKSVTFFNEDCLCSHGDLCISEGSRKLVSEEVWCKCRKYFPKAPEFLSCAQPCELCAINK
STHNEESAALKLLAVQQKQALHFLLENPINRMAQLMQQNGIYHIIQYSFIDAWKKSFSL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaaaatgttcccgattttctgatgtaaatattaattctttttgtgaactcgga
gcatgcagaacaaactgtaaaaaaaatgtcaactgtttctctcaattgggcgaaaaattt
tggtttagtgatattaaagagacttattgggttagccccattgatagtgagtcagaaaga
agaataaagggaaatcatgtaggattaaaaaatcttggagccacttgttatgttaacaca
attttgcagctttcatttcataataaagcatttcgttctgcaatatatcaatggaaattt
tctgacggttttgtacctaagttgatagtcaaagacagtaatgcagatgcatctaaatct
cttctattagaatttgatgacaatcaaaccaataaaatttgtggaaaccttcaatatttg
tttgcattacttgaattaagtaatagaagatatgtagatccttcatcttttgttgaatgt
cttggattacaaacaaatgaacagcaagatgctcaggagtttagcaaactttttattaca
cttcttaataatgcattttcttctcaagatggttttctttctaatataattcattcacag
tttggtggacaatataagtatgaaactaaatgtaatgtgtgtctgaacaaatcagtcaca
tgctcagatttttatgagcttgatttaaatgttaaaggtcatagttcattgcatggttgt
ttaaaagaattcttgcaagaagaaatcatggaaggtgaaaaccaatatttttgttctatt
tgttgctgcaagcaaaatgctttacgtaaaattgtattggaaaaattgccacctgttttg
aagctaaatcttcttcgatttgtgtttgaaagagaaactggaacaaagaaaaaaattaat
acagctcttaatttccctgaaactattgacatggggaagtacataaagtttgacaatcct
gaagatgggctctatcatttgtcttctgtgttgattcatcggggacttagtgcacattct
ggtcattacattgctcatatctatgatgaagagaataatatatggtgtcgttttaatgat
gaagaggttaccataatgaagggaaaaacattgcaacttggggttgaagataatttagaa
gattttggtgaaacgaaaagtaagaaacctcgaaagtgtgaccaagatacaaaaaatcac
aattctaaaaatgcttacatgcttgtgtacaccaagactgttggttgcttggacaggaca
ggagtggcagtaagtttagagaatggaaagagctattgggtaggaaaaaaatctttaaag
aaaattaagttattagcacaacaagagtttgttaaatgcaaaacatcggtttgtcaagca
aatgaagaaacaattggaaaaatcaatgtggaaattcacggaaaatctaagattgaaaat
tttaaaagtgtaacattttttaatgaagactgcttatgttcacatggagacctatgtata
tcagaaggttcacgaaaacttgtttcagaagaagtgtggtgtaaatgtagaaaatacttt
ccaaaagctcctgaatttttatcgtgcgcacaaccatgtgaattatgtgctataaataaa
agtacacacaatgaagaaagcgcagcgttaaaattattagctgttcaacaaaagcaagcg
ttgcattttctacttgaaaatccgattaatcgaatggcacaattaatgcagcagaatgga
atttatcatattatccaatattcctttattgatgcatggaagaaaagttttagtctgtaa

DBGET integrated database retrieval system