KEGG   Hydra vulgaris: 100197152Help
Entry
100197152         CDS       T01080                                 

Gene name
hadha
Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
hmg  Hydra vulgaris
Pathway
hmg00062  Fatty acid elongation
hmg00071  Fatty acid degradation
hmg00280  Valine, leucine and isoleucine degradation
hmg00310  Lysine degradation
hmg00380  Tryptophan metabolism
hmg00410  beta-Alanine metabolism
hmg00640  Propanoate metabolism
hmg00650  Butanoate metabolism
hmg01040  Biosynthesis of unsaturated fatty acids
hmg01100  Metabolic pathways
hmg01200  Carbon metabolism
hmg01212  Fatty acid metabolism
Module
hmg_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
hmg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100197152 (hadha)
   00650 Butanoate metabolism
    100197152 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    100197152 (hadha)
   00071 Fatty acid degradation
    100197152 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    100197152 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100197152 (hadha)
   00310 Lysine degradation
    100197152 (hadha)
   00380 Tryptophan metabolism
    100197152 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100197152 (hadha)
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100197152 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100197152 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Mg_chelatase NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 100197152
NCBI-ProteinID: XP_012556619
Position
Un
AA seq 773 aa AA seqDB search
MLSFHAKNGVKGFYRASKNFRLNMDLGSFKKLYSTEIKGMDVCNERNHINYVVKDNVAVV
TINDKNSKVNVLSQNVIEETVQVFKEVTHNPNVSSVVLISGKPDCFIAGADINMLNTANS
LEKGTAISVEGQKIMNMIFDSKKPVVAAINGSCLGGGLEVALACHYRIAVDSPKTGLGVP
EVMLGLLPGAGGTQRLPRLVGLPTSLDMMLTGKTVNATKAKKLGLVHSVVDQLGPGVSDS
KANTMRLLEEVAVKAAKDLASGKLQVSQSKPWFSLAGLQHNIPLSFGPLRDYVFKKAKET
VMKKTLGLYPAPLKILKATQTGLEKNIEAGFKEESQGFGELTQSKEAKSLMGLFNGQTEC
KKNRFGAPKHKVQHVAVLGAGLMGAGIAEVSINKAHHNVILKDTTTDGLSRGIDQIYKNI
NLRASKRQITTFERDVIMSKLQTQLDYSNFSEADMVIEAVFEDIKVKHKVLQEVEKVIPE
HCVFASNTSAIPIAEIASVSKRPENVIGMHYFSPVDKMPLLEIITTEKTSKETIASAVDV
GLKQGKTVIVVKDGPGFYTTRILMPTLMEALQLLSEGINPRDLDQRSKNFGFPVGCVTLV
DEVGIDVAAHIANHLGNIFKGRMVGGNIQMLNDMVDRGFLGRKSKKGFYKYANKKEVNEG
ALEIIKKYQKTPVTGLTDDETALRLVSRMTNEAVLCLEEGILNSPVDGDIGAVFGLGFPP
PHGGPFRFVDTYGAGNLVKLMEKYQKLIGESQFKPAQLLLDHAKNSSKKFYVK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcatgcaaaaaatggagttaaaggattttacagagccagtaaaaatttt
aggctaaacatggacctgggtagttttaagaaactttatagtacagagataaaaggtatg
gatgtttgcaacgaacgcaatcatattaattatgtagtgaaagataatgttgctgtagta
acaattaatgataagaactcaaaagttaatgttttgtcacaaaatgttatagaagaaaca
gttcaggtttttaaagaggttacacacaatcctaatgtcagcagtgttgttttaatatct
ggcaagcctgattgttttattgctggtgctgatatcaatatgttaaatactgcaaactca
ttagaaaaaggaacagctatctctgttgaaggacaaaaaataatgaatatgatttttgat
agcaaaaaaccagttgttgctgctatcaatggttcctgtcttggcggaggtctagaggtt
gcattggcatgtcattatagaattgcagttgatagcccaaaaactggcttaggtgttcct
gaggtaatgttgggtttactacctggtgctggtggaacacagaggcttcccagattggtt
ggtctaccaacttctcttgacatgatgctgactggtaaaactgtcaatgctactaaagca
aaaaaacttggtttagtgcacagtgttgtagatcaactcggtcctggagtcagcgatagc
aaagcaaatacaatgcgtttattagaagaagttgctgttaaggctgctaaagatttggca
tcaggaaagctgcaagtttcgcaaagcaaaccatggtttagtttagctggtttgcaacat
aatatcccattatcatttggacctttaagggattatgttttcaaaaaagctaaagaaact
gtaatgaaaaaaacacttggtttgtatcctgctccattaaagattcttaaagctactcaa
actggtttagaaaaaaatattgaagccggatttaaagaagaatcccagggttttggagaa
cttacacagtcaaaagaagctaaatcattgatgggattatttaatggtcaaactgaatgc
aaaaaaaatagatttggggcgccaaaacataaagttcaacatgttgctgttcttggtgct
ggtcttatgggtgctggcattgctgaagttagtattaacaaagcccatcataatgtcata
ctaaaagatactactacagatggtttatctcgtggtatagatcaaatttacaaaaatatt
aacttgagagcaagcaaaagacaaatcactacatttgagcgtgatgttattatgtcaaag
cttcaaactcagttagattattcaaatttttctgaagcagatatggtcattgaagctgtt
tttgaagatatcaaagttaaacataaagttttacaagaagttgaaaaagttatacctgaa
cattgtgtctttgcatcaaatacttctgctattccaattgctgaaattgcttctgttagt
aaaagaccggagaatgtaattgggatgcattacttttcacctgttgacaaaatgcctctc
cttgaaattatcactacagaaaaaacttcaaaggaaacaattgcttctgctgttgatgtt
ggtttaaaacaaggaaaaacagttattgttgtaaaggatggtcctggattttatacaact
cgaattcttatgccaactttgatggaagctcttcagcttctttcagaagggattaaccca
cgtgatcttgatcagcgctcaaagaattttggttttcctgtgggatgcgtaacattagtt
gacgaggttggaattgatgttgctgcacatattgccaatcatttgggtaatatctttaaa
ggaagaatggttggtggaaatattcaaatgcttaatgatatggtagacagaggattttta
ggaagaaaatcaaaaaaaggtttttacaagtatgcaaacaaaaaagaggtaaatgaaggt
gcacttgaaatcattaaaaagtatcaaaaaacaccagtaactggtctaacagatgacgag
acagctcttcgcttagttagtcggatgacaaatgaagctgttttgtgtttagaagaagga
attctcaacagtccagttgatggtgatattggtgctgtgtttggcttaggctttccacca
ccacacggaggaccctttcgattcgtagatacatatggagcaggcaatctagtaaagttg
atggaaaaatatcaaaagcttattggagagtcccaatttaagccggctcaacttctccta
gatcatgcaaaaaattcttcgaaaaagttttatgtgaaataa

DBGET integrated database retrieval system