KEGG   Hydra vulgaris: 100197178Help
Entry
100197178         CDS       T01080                                 

Definition
serine/threonine-protein kinase mTOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
hmg  Hydra vulgaris
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100197178
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100197178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2450 aa AA seqDB search
MMLQQKMLQILNGLKSPNENHRNKVAQELQHFFTTELREIPADQLNELMDMLTHHICELV
NSTNVNEKKGGILAIVGLINADGNSNRTSRFVNYLRNMLPCSDVTVMEMVAKTVGRLSQV
GGTFSSDYVEFEIKKALEWLYGDRHEGRRHAAVLVLRELAITAPTFFFQHVQSFFDYFFN
AVRDPKPQIREGAAEALRACFAIIAQRETKKNHYTHYYKQVYTEAMKGIDDGATSRERGN
ILSKEDKVHGSLLVLQELIRNSSIEGERLRQQMEEVYGDKTSQEIYSRDIPWSKSSRFLS
HQAHPIQLSFMPLNVGHQIPLSQSRYCKEFMETHFDDVCNAVLSQRSFKSSLVQHTLLTF
LPQLAAFNSKSFKKTYFKTTISHMINALKKDREKSTAFEAIGLLALALKNDIATGLQEWK
SVLEHIKLLLINKEPLNRRRTTPIDSMVFACVSMTARAFGQKHFAKEIQDIIILMLSAGL
SPALTASLQELAEAMPIMKKQIQNGLVALLTNILEQRPIRQTGLPKSAAATTTAVSGTTS
ADDDIAMTTLALRTLGTFDFEGLGLARYITSCAAFLLNENKRIRIEAVRTCSYLLEPTLH
PMVVPNVSISYPISSANTQVVSEVLSKLLTVGITDQDPDIRFCVLKSLDQKFDSHLAQAE
NLQALFIALNDEEFEIRELALCMIGRLSSYNPAYIMPSLRRTLIQILTELEYSGVGRSRE
QSARMLAHLVSNAPRLIRPYMEPILKALVPKLKDKDPNPGVVTSILATIGELAQVGGFEM
RKYIDELFPVIIEMLQDASSLAKREVALCTLGQLVESTGYVVEPYKKYPNLLEVLLNFLK
TEQSPGVRKEAIRVLGLLGALDPYKYKQITNAKDALTKKDDAENSESNASEMLVNMGSAQ
LDDFYPAIVIASMMRIMRDPVLAAYHHTAIQAVHFIFNNMGMKGVQYLPQLMPSYLNVIR
TCEPGFRDYVLQMLGQLISVVKQHIRNYLDEIFSLIREYWVLTSQVTLQNTFIDLIVQLS
IALGGEFKLYLPQILPHMLKVFNNDQSEHQVVTCKLLTSIQKFGESFDDYLHLLIPPVVK
LFDSTSAQLTKEVQLAALETLEKLCDCADLREFSARIIHPIIRVLDNFPELRPAAMKTLA
AIASQMGKSFSIFAPAVSKVLSRHKISDLNYDCIIARINKGSIDYETDPLYKRKHNKSNL
QNDQTLVAPSDGLRKMVVKANCLQKAWTSVCCISKDDWIEWLRRFSQELIKESPSPVLRS
CQLLAQQYNPLARDLFNAAFVSCWSELSEEQQDELVASLEQALKSQNIQQITQTLLNLSE
FMEHCEIKGTFSLNIELLGECATNCRAYAKALHYKEEEFQKAVTTEVLESLISINNKLQN
PEAANGVLLYAMRNSKVDYKVQQRWFEKLHDWEHALEAYEIKNEQNPNDDDLLLGRMRCL
EALGKWRELNKLATEKWQSVEDNIRHKMARTAASAAWGLGEWEHMEEYTCMIPREKLEGA
FFRAVLALHKDQYDRAQSCIDSARDMLDTELTAMVGESYNRAYGSMVTVQMLSELEEVIT
YKLCAERREAIRQAWWDRLQGCQPVVEDWQRILQVHSLVLKPQDNQKTWLKYASLCRKSG
QLALSYQTLITLLGTDPSLSPDQPIPSNFPKVTFAYMKHLWKSGQRDSAFFNLQHFVRNT
LRPKAYQVSPSEENENSQALVCLLAKCHLKLGEWMTVIQGINSTTITPILQYYAAATENA
SKWYKAWHSWALMNYESVLYYKNSQPLSASQFSPPGSPRKTTDPSVQNYIVPAVEGFFRS
IALFMGNSLQDTLRLLTLWFEFGHWPDVHEALVNGIKTIHIDNWLQVIPQLIARIDSPRQ
LISRLIHQLLSDVGKQHPQALIYPLTVASKSPNADRHNAANQILQNLCEHSSALVQQAMM
VSEELIRVAILWHELWYEGLEEASRLYFGERNVKGMFGVLEPLHMMMERGPQTHNETSFQ
QAYGRDLMEALEWCRNYQKTNNDKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLL
NCIDLELAMPGTYEPDKPITRIKNISTTLNVITSKQRPRKLTITGSNGAVFMFVLKGHED
LRQDERVMQLFGLVNTLLSNDSVTFKRHLSIQRYAVIPLSTNSGLIGWVPYCDTLHTLIR
DYREKKKILLNIEHRIMLRMAPDYEHLSLMEKVEVFEHALSNTQGDDLAKILWLKSPSSE
VWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKF
PEKVHFRLTRMLINAMEVTGIDGNYKMTCESVMKVLHENKDSLMAVLEAFVYDPLLNWKL
IDRAAPKEKRSQGRTGEEFQESFDHTHDRPRGNKAAAAEQPLQNLEDGAKPEAVNKRALQ
IINRVRDKLTGRDFNNNEAIEVEKQVDALILQATSHANLCQAYIGWCPFW
NT seq 7353 nt NT seq  +upstreamnt  +downstreamnt
atgatgctacagcaaaaaatgttacaaattttaaatgggctaaaaagtccaaatgaaaat
catagaaacaaagttgctcaagagttgcagcattttttcacaactgagctaagagaaata
ccagcagatcagcttaatgaattaatggacatgttaactcatcatatatgtgaattggtt
aacagtaccaatgtaaatgaaaagaagggtggaatattagcaatagttgggcttatcaat
gctgatggtaattcaaaccgtacatctcgatttgtcaattacttaagaaatatgctacca
tgcagtgatgtaacagtcatggaaatggtggcaaagaccgttggtaggttatcacaagtt
ggtggaacattttcatcagattatgtagagtttgaaattaagaaagctttagaatggctt
tatggagatcggcatgaaggaagaaggcatgctgctgtgcttgtactaagagagctagca
ataacagcaccaacctttttcttccaacatgtccaatcgttttttgattattttttcaat
gctgttcgtgatcctaagccacaaatccgtgaaggagctgcagaagctttgcgagcatgt
tttgcaattatagctcaacgagaaacaaagaaaaatcactatactcactactataagcaa
gtgtatactgaagcaatgaaaggaatagatgatggagctacttcaagggagcgtggaaat
attttaagtaaagaagataaggttcatggttctttacttgtattacaggaacttattaga
aatagcagtattgaaggagagagattaagacagcaaatggaagaagtgtatggagataaa
acctctcaagagatatatagtcgagatataccatggtcaaaatcgtctcgttttctttct
caccaagctcatccaattcaactctcatttatgccactaaatgttgggcatcaaattcca
ttatctcaaagtcggtactgcaaagagttcatggaaactcactttgatgatgtttgcaat
gctgtccttagccagagatcatttaagagtagtcttgttcaacacacgttgctcactttc
cttcctcaacttgctgcttttaattctaaatcatttaagaagacgtacttcaagacaaca
atttctcatatgatcaatgctttaaaaaaggatcgtgaaaagtctacagcatttgaagct
atagggctgctagcattggcattaaaaaatgatatagctacaggcttgcaagaatggaaa
agtgttcttgaacatatcaagcttttgttaattaataaagagccacttaacagacgacga
acaacacccattgattctatggtttttgcttgtgttagtatgactgcgagagcttttggt
caaaaacattttgccaaagaaattcaagatatcatcatactaatgcttagtgctggttta
agtcctgctttgactgcatcactccaagaattagctgaagcaatgccaattatgaaaaaa
caaattcaaaatggtttggtagcattgttaacaaacattcttgaacaaaggcctattcgt
caaacaggtcttccaaaaagtgctgcagctactactactgcagtctctggtaccacaagt
gctgatgatgatattgctatgacaacattagctctgcgaacacttggaacatttgatttt
gaaggactgggattagcgcgctacattactagttgtgctgctttcttattgaatgaaaac
aaaagaatcagaattgaagcagttcgtacatgttcatatctattggaacctacattacat
cctatggtagtaccgaatgtatcaatttcttatcctatcagttcagcaaacacccaagtt
gtaagtgaagttctcagtaagctgcttactgttggaataactgatcaagatccagacatt
cgcttttgtgtgcttaaatcattggaccaaaagtttgattctcacctggctcaagctgaa
aacttgcaggcattatttattgcattaaatgatgaagagtttgagattcgtgaacttgcg
ctttgcatgattggcagattaagtagttacaatccagcttatattatgccttctttaaga
agaactcttatccaaatactaactgaacttgaatatagtggtgttggaagaagtagagag
cagagtgcgagaatgcttgcacacctagtttctaatgctcccagattgattcgaccatac
atggagccaattttaaaggctctagtacctaaattaaaagataaagatccaaaccctggt
gttgtaactagtattcttgctactattggggaactagcacaggttggtggttttgaaatg
cgaaagtatatagatgagttatttccggttataattgaaatgcttcaagatgcttcttcc
cttgcaaaaagagaggtcgcattatgtacactaggacaactagtagaaagcacaggatat
gttgttgagccatacaagaagtatccaaatttgcttgaagttcttctgaactttcttaag
actgaacagtctcctggagtcagaaaagaggcaattagagtattggggttgcttggtgct
ttagatccatataagtataaacagataacaaatgctaaagatgctcttacaaaaaaagat
gatgcagaaaattcagaatcaaatgctagtgaaatgcttgttaatatggggagtgctcag
cttgatgatttttatccggccattgttattgcttctatgatgcgaataatgcgtgatcca
gtgcttgcagcatatcatcatactgcaattcaagctgttcattttatatttaacaacatg
ggaatgaaaggtgtacaatacttaccacaattaatgccttcttatttaaatgtcataagg
acctgtgagcctggctttcgtgattatgtgttacaaatgttgggtcaactaatatcagtg
gtaaaacaacatatcagaaactatttagatgaaatttttagtttaatacgagagtattgg
gttcttacaagtcaggtaacattgcaaaatactttcatcgatttgatagtgcagttatct
atagctcttggtggagagtttaaattgtacttgccgcaaatcctacctcacatgctcaaa
gtttttaataacgatcagagtgaacatcaagttgtcacctgcaagcttcttacaagtatt
caaaaatttggtgaaagttttgatgattatttacatttgcttataccccctgttgtaaaa
ctgtttgactctacatctgctcagctaactaaagaagttcaattagctgctctagaaaca
cttgaaaaactatgcgattgtgctgatttacgagagttttcagctcgaataattcatcca
attattcgtgtgctagacaattttcctgaattacgccctgctgcaatgaaaacactagca
gctattgcatctcagatgggaaagagtttttcaatttttgctccagctgttagcaaagtt
ttatcaaggcacaagattagtgaccttaattatgactgcatcattgcaagaattaacaaa
ggatctattgattatgaaactgatccattatataaacgcaaacataacaaatcaaacttg
caaaatgatcaaaccctagtagctccaagtgatggcttaagaaaaatggttgtaaaagcc
aattgtcttcaaaaagcatggacatcagtctgttgcatatcaaaagatgattggattgaa
tggttgcgtcgatttagtcaagagctaataaaagaatcgccttctcctgtactacgctca
tgtcagctgttagcacaacaatataatccacttgctagggatcttttcaatgctgcattt
gtgtcttgctggtctgaactctcagaagaacagcaagatgaacttgttgcaagtttagaa
caagcattgaagtctcaaaacattcaacagataacacaaacccttttgaacttatcagag
tttatggaacattgtgaaataaaagggacattttctttgaatatcgagctacttggtgaa
tgtgcaactaattgtagagcctatgctaaggctcttcattataaagaagaagaatttcag
aaagcagtaacaacagaagttcttgagtccctaatcagcatcaacaataaattacaaaat
cctgaagctgctaatggagtactgctttatgcaatgcgcaattctaaagttgattataaa
gtgcagcagagatggtttgagaaattgcatgattgggagcatgcattagaggcgtatgaa
attaaaaatgagcaaaatcctaacgatgatgacctgcttcttggtagaatgaggtgctta
gaagcccttggcaaatggagagagttaaacaaactcgccactgaaaagtggcaaagtgta
gaagacaacatcagacataaaatggcaagaactgcagcatcagctgcatggggcctaggt
gaatgggaacatatggaagaatacacatgcatgataccaagagagaaactagaaggtgca
ttttttcgagctgtattagcattacataaagatcaatatgaccgtgcacaaagttgcatt
gacagtgcaagggatatgcttgacacagaattaacagccatggttggagaatcttataat
cgagcttatggatctatggtaactgttcaaatgttgtctgaacttgaggaggtcattact
tataaattgtgtgcagagcgcagagaagctattcgtcaagcatggtgggatcgtttgcaa
ggatgtcagccagtagtagaagattggcagcgaatactgcaagttcattcacttgtgctt
aaaccacaagataatcaaaagacatggttaaagtatgcaagcttgtgcaggaaatcaggg
cagctggcactgtcttatcaaacattgattaccttgctgggtactgatccttcactttca
cctgaccaacccattccatctaattttcctaaagtcacatttgcatacatgaaacatttg
tggaaaagtggccaaagagatagtgcatttttcaatctccaacactttgtacgaaacaca
cttcgtcctaaggcatatcaagtatcaccatcagaagaaaatgaaaatagtcaagcactt
gtgtgtttacttgccaaatgtcacttaaaactcggggagtggatgacagttattcaaggt
attaactctacaacaattacaccaattcttcaatattatgctgcagctactgaaaatgcc
agcaagtggtataaagcatggcactcatgggctttaatgaattatgaaagtgttttatat
tataaaaatagtcaacccctttctgcatcacaattttctcctcctggttcaccacgaaag
actactgatccatctgttcaaaactacattgttccagctgttgaagggttttttcgttct
attgctttatttatgggaaactctttgcaagacaccctcagattgcttactctatggttt
gagtttggtcattggccagatgttcatgaagctttagtaaatggtataaaaacaattcac
attgataattggttgcaggtgatacctcaattaatagctagaatagattcgcctcgtcag
ttaatcagccgacttattcatcaacttctatcagatgttggaaagcaacatcctcaggca
ttaatatacccattgactgttgcatcaaaatccccaaatgctgatcggcacaatgcagca
aatcaaatcctacaaaatctatgcgaacacagctctgcacttgtgcagcaggcaatgatg
gttagtgaagagcttattagagttgctattttatggcatgagttgtggtatgagggcctt
gaggaagcatcaagactttattttggagagagaaatgtgaaggggatgtttggtgttctt
gaaccacttcatatgatgatggagagaggaccacaaacacataatgaaacttcattccag
caggcttatggtcgtgatttaatggaggctctagaatggtgtcgaaattatcaaaaaact
aataatgataaagacttgactcaagcttgggatctttattatcatgtttttaggcgaatc
tcaaaacaactccctcagttgacttctttagaactgcagtatgtatctcctaaacttttg
aactgtatagatctagaattggctatgccaggtacttatgaaccagataaaccaatcaca
cgcataaaaaatattagtactacattaaatgttattacatcaaaacaacgtcctcgtaag
ttgaccatcacaggcagcaatggtgcagtatttatgtttgtgctgaaaggacatgaagat
ttaagacaagatgagagggttatgcagttgtttggattagttaatactctcctttcaaat
gattctgttacatttaaaaggcatttaagtattcaacgttatgctgtgatcccgttgtct
acaaactctggtctaattggatgggttccatattgtgatacacttcacactttaattcgt
gattatcgagagaagaaaaaaattcttttaaatattgagcatcgaattatgttacgaatg
gctccagattatgaacacctgtcattgatggagaaagtggaagtttttgagcatgcatta
agcaacactcaaggagacgacttagcaaaaatactttggttgaaaagtccaagttcagag
gtttggtttgatcgtcgcactaattatactagatcgttagctgtaatgtcaatggttgga
tatatattaggtctcggtgacaggcatccttcaaatttaatgttggatagaatgtctggt
aaaattctacacattgattttggggactgttttgaagtggccatgactcgagagaaattt
cctgagaaagttcactttaggttgacaagaatgttgataaatgcaatggaggtgacagga
atcgatggaaattataaaatgacatgcgagagtgttatgaaagtccttcatgagaataag
gacagcttgatggcagtgttggaagcatttgtttatgatcctttgcttaattggaaactg
attgacagagctgctcctaaagaaaaaagatcacaaggtagaactggtgaggaatttcaa
gaaagttttgatcacacccacgatcgaccccgtggtaacaaagcagctgccgccgaacaa
cctttacaaaatttagaagatggagcgaaacctgaggctgttaataagcgagccttacag
atcatcaatcgagttagagataagcttactggtcgagattttaataacaatgaggccata
gaagtcgaaaaacaggtcgacgctttaattcttcaagctacttcacatgcgaatctatgc
caagcttacattgggtggtgtccgttttggtaa

DBGET integrated database retrieval system