KEGG   Hydra vulgaris: 100197205Help
Entry
100197205         CDS       T01080                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
hmg  Hydra vulgaris
Brite
Enzymes [BR:hmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100197205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 279 aa AA seqDB search
MEQNLTVFSYKTLEFETFLNLFMQREQEILNSVTTSIFTGGFIVFITTLWLPAPYGRYSY
TGKLFLLPISPRFGWFLQELPAFLVPCIVIGSSCLSNSQYKFSRLQLTVLGCFVLHYLIR
TFYYSYNINGGKSSPLIGYLLAGSFCFINGYIQSRGMLLSKSTLDDNLTRVVFGILIFLV
GLAINVHSDFLLSNLRQPGETDYKIPKGGLFNVVSCANYTGEITEWIGFAIAAWNLYAFS
FAYFTMAFLVPRAIRHHRFYQEKFKDYPKNRKAVLPFLL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaacttaacagttttcagttataaaactttggagtttgagacttttttaaat
ctctttatgcaacgtgaacaagaaattttaaactcagtaaccacttcaatctttacaggt
gggtttattgtttttataactacactttggctacctgcaccttatgggcgttactcatat
actggaaaattatttttattaccaatatctcctcgctttggatggtttttacaagaattg
ccagcttttttagtaccttgtattgttattggaagttcttgcttgagtaactcgcaatat
aagttttctagacttcaattaactgttctcggatgttttgtgcttcattacctaattaga
acgttttattattcttacaatataaacggaggaaaatcgtcaccgcttattggctactta
ttggctggttcgttttgtttcataaatggatatattcaatcgcgtggcatgctattgtct
aaaagcactttagatgataatcttacacgagtagtttttggtattttgattttcttggtt
ggcttggcaataaacgtgcacagtgactttcttttaagcaatttgcgccaacctggtgag
acggactacaagataccaaaaggtggtttgtttaatgttgtttcgtgtgcaaattacact
ggggaaattacagaatggattggttttgcaattgcagcttggaatttgtacgcattttca
tttgcttattttacaatggcttttctagttccaagagctatacgacatcacaggttttac
caagaaaagtttaaagactatccaaaaaatagaaaagctgtcctgccgtttttattatga

DBGET integrated database retrieval system