KEGG   Hydra vulgaris: 100197385Help
Entry
100197385         CDS       T01080                                 

Definition
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1-like
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
hmg  Hydra vulgaris
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hmg00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hmg04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 598 aa AA seqDB search
MEYCSRKMILILSCLVIFSIFNVRADLEISNVDRSIDLSSQLAKVNSQITLQNKGNKAVT
SFLISIEEDQFPLLSYLEVTHKEDDESVKLETTPSSVAGQSAKLFSVNLPSSLGVGKSIV
LNIESVFTHALRPFPAKIGQSEKQLVIYKANTYFSSPYKVVYQKTTVKLSSSTIESYSKL
KPSNSADNTITYGPYNDINPYSFHEMKIHFENNSPFLTVKDMTRWIEVSHWGNVAIEETY
HLLHEGAELKGHFSRYDYQRTPSHAAVKSIKSVLPAAAKDVYYRDEIGNISTSNLLNTHD
SVELELRPRFPLFGGWQTQYLIGYNVAVYEYLFRKGSNYVLKMRFIDHVFDDFVIDKVTV
KVVLPEGATNIKVKFPFEIKQEKQELHKTYLDTCGRPVFVMSKKNLVENHIQDFELHYTF
QSHLLLQEPILCVAAFYILFISVICIMRLDFSITKDAVNESRMKVASLVESLLAACDRRT
GLNSSFDSALDNFKQSKDQVSFTSALKKVNHDYNTLCATINNLIASLLKEEPEYSDKLSD
ITKKEAERKALIDQQVALATKAVSGKLSKQQYTDSEQIALSKREKITEEIEATLAALS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggaatattgtagtaggaaaatgattttaattttgtcatgtttagttattttttcaatt
tttaatgttcgtgccgatcttgaaatatcaaatgttgaccgttctattgatctaagtagt
caactggccaaagtgaattctcaaattacgcttcagaataaaggaaacaaagctgttacc
tcctttcttatttctatagaagaggaccaatttcctttactttcttacttagaagttaca
cataaggaagatgatgaaagtgttaaacttgagactactccatccagtgttgcaggccaa
agtgcaaaattatttagtgtaaatcttccaagtagtttgggagttggtaaaagtattgtt
cttaatattgagtctgtatttactcatgctttgagaccattcccagcgaaaattggccaa
tcagaaaagcagttagtcatatacaaagccaacacctatttctcttcgccatacaaagta
gtttaccaaaaaacgacagttaagctttcttcatccacaattgaaagctattccaaatta
aagccttctaactcagctgataacactatcacttatggcccatacaatgatattaaccca
tacagctttcacgaaatgaaaattcactttgagaataattctccatttcttactgttaaa
gatatgacacgttggattgaggtttcacattggggtaatgtagctattgaagaaacctat
catcttttacacgagggagcagagcttaagggtcatttttcacgctatgactaccaaaga
accccatctcatgcagctgtgaaatctattaaatctgttcttcctgctgctgccaaagat
gtttattatcgtgatgaaataggcaatatttctaccagtaatcttttgaacacacatgac
tctgttgaactcgaattgagaccaagatttccattgtttggaggttggcaaacacaatac
cttattggctacaatgttgctgtttatgaatatctcttcagaaagggttcaaactatgtc
cttaaaatgagatttattgatcatgtttttgatgattttgtcattgataaagtcactgtc
aaggttgttcttcctgaaggagcgacaaacattaaagtcaagtttccttttgaaatcaaa
caagagaagcaagaacttcataaaacatatttagatacttgtggaagacctgtttttgta
atgagtaagaaaaatttggtagaaaaccatattcaagattttgagcttcattacacattt
caaagtcatttgttactacaagagccaattctttgtgtagctgctttctatattctgttt
atcagtgtaatatgcattatgcgattagatttctccatcacaaaggatgctgttaatgaa
tcacgtatgaaagttgcaagccttgttgaatctttattggctgcctgtgatcgtagaaca
ggactgaactcttccttcgattcagcattagataatttcaagcaaagtaaagatcaagtt
agttttacttcggcgttaaaaaaagttaatcacgattataatactttgtgtgctactatt
aacaatcttattgcctctctgttaaaagaagaaccagaatattctgataagctctcagat
ataacgaagaaagaggctgagcgcaaagctttgattgatcagcaagtggctttagcaact
aaagctgttagtggaaagcttagtaaacaacagtacactgatagtgaacaaattgctcta
tctaagcgagagaaaatcactgaagaaatagaagccacattggctgcgctttcttaa

DBGET integrated database retrieval system