KEGG   Hydra vulgaris: 100197403Help
Entry
100197403         CDS       T01080                                 

Definition
serine/threonine-protein kinase NLK-like
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
hmg  Hydra vulgaris
Pathway
FoxO signaling pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100197403
   04068 FoxO signaling pathway
    100197403
Enzymes [BR:hmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100197403
Protein kinases [BR:hmg01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100197403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 362 aa AA seqDB search
MALCKAHGLYNTSSALTPQSNITDDDGPTVKKFHSNVNSKDSKTFEIDRPIGYGAFGVVW
AVTDPRTGKRIALKKMPNVFQNIVSSKRVYRELRMLTYFKHENVLRALDILQPDPLDRMH
ELYVVTELMQSDLHKIIVSPQPLSSDHIKVFLYQILRGLKYLHSSGIIHRDIKPGNLLVN
SNCLLKICDFGLARCEEPNRSREMTQEVVTQYYRSPELLSGATYHSYGVDIWSVGCIFAE
LLGRKILFQAQSPIHQLNQVIKLLGTPHPDDIRSSGASEGAFCYIMSQPYRPPAMHTLHN
LSSRANHEAIHLLCRMLVFNPNKRITVTDALTHPYLDEGRLRYHTCMCSCCSTSAAGRQY
VN
NT seq 1087 nt NT seq  +upstreamnt  +downstreamnt
atggctctatgtaaagcccatggtctttataatacatcgagtgctttaacaccacagtcc
aacataactgacgacgacgggcctactgtaaaaaaatttcatagtaatgtaaattctaaa
gattcaaaaacttttgagatagatagacctatcggatatggagcttttggagttgtatgg
gctgtgactgatccacgtacaggaaaaaggatagccctgaagaagatgcccaatgtcttt
caaaatatagtatcaagcaaacgcgtttatagagagctgcggatgcttacttacttcaaa
catgaaaatgttttgagggcattagatattcttcaacctgatcctttagatagaatgcac
gaactatacgttgtaacagaacttatgcaaagtgatttacataagatcattgtatcacct
caacctctatcttctgatcatataaaggtttttctttatcaaatactaagaggattaaaa
tatttgcattcatctggcattattcatcgtgacattaagccgggtaatctattggtaaat
agtaactgccttttaaaaatatgtgattttggacttgctcgttgtgaagaaccaaacagg
tctagagaaatgacacaagaggttgttacacaatactatcgatcacctgaacttctttct
ggagcaacttaccattcgtatggagttgatatatggagtgttggatgcatttttgctgag
cttcttggtagaaaaattcttttccaagctcaatctccaattcatcagctaaatcaagta
attaaactactgggtactcctcaccctgatgatattcggtcatcaggtgctagcgaaggt
gcattttgttacattatgtctcaaccttaccgaccaccagcaatgcacactcttcataat
ttatctagccgagctaatcatgaggcaatacatttactttgtagaatgcttgtttttaat
ccaaataagcgtataactgttacagatgccctaacacatccatacttagatgagggcaga
ttgcgctatcatacatgtatgtgctcctgttgttcaacttctgctgctggaaggcaatat
gttaatg

DBGET integrated database retrieval system