KEGG   Hydra vulgaris: 100197596Help
Entry
100197596         CDS       T01080                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
hmg  Hydra vulgaris
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100197596
Protein phosphatases and associated proteins [BR:hmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100197596
Ubiquitin system [BR:hmg04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     100197596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 787 aa AA seqDB search
MAVQEPLKVAVWHALNAYCYKDAIFLAERLYAEVSSEEVLHLLATCYFRSGHTNRAYSLL
KKNSYTNIQTRYLFAWICFQLEKLSEAENALLGNHNKSILNTSNEFGSLSGAALQLLGKI
YRKTGQSSKAAECFRESLRCNPFLWHSFEQLCQTGEKIDPVDFFKTTSSAKATQPSIIKN
SEFSPFDLISNYKNVYSENLDPAKSGPLFTSTVVSKPTLQEHLSTVNYEWNDGDSDMPPP
QSIALKKSRVPVKARQRIIGTKTSDSPVTPNFGVLPTDSPVVELGSSPNFITPPISSLNE
NPLKAPLKAPHRQTTVKINGSRHSSLGFSSFGSPSPISQLVVTTNCTSLRRSNRLFDSSA
KDIKKTPRVRFADSNKPITTARKTKSRLTHVSQPLTPTIQNIQSAAKNENLISEIKDEKP
TSISLSPIQQNSDIWMRLFQDLGKAYHALSIYDSKKAVDYFSSLPLNHQTTNWVMEQLGL
AYYEMGDITAAQKVFEKVRENDPDYISDGMAVYSSLLWLSRKDCELSCLAQSLVDSDKNS
AVAWCAMANCFSLQKEHNTAIKFLHRAVQLEPEFSYAYTLLGHEYVFIEDFDKGISCFRT
ALRYNEKHYNAWYGIGMIYYKQDNFSMAKLHFQLALKINPRNSVLLGHLAVTQHELGETD
LAMDTINKAIEYNSKSALCKYHRARFYFDSERLQEALEELIEVKKLAPKDSLIYYMIGKV
YQKRNEIVLAQQNFSWAMSLNPHGPNNMIKEAMNQLQNYSREDILTSAVVDSMEDDNGMS
DISNSNL
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcaggaacctcttaaggtagctgtttggcatgcacttaatgcatattgttat
aaagatgccatatttctagctgaaagactgtatgctgaagtttccagtgaagaggtgttg
catttattagctacatgttattttcgctctggacacactaatcgagcatatagtttgtta
aagaaaaattcttatactaatatccagacaagatacctttttgcttggatatgttttcaa
ctggaaaaattaagtgaagcagagaatgcattacttggaaatcacaataaatcaatattg
aacacttctaatgagtttggttctttatcaggtgcagctttgcagttgttgggtaaaata
tatagaaaaactggccaatcatctaaagcagctgaatgttttcgtgaaagtttacgatgt
aatccttttttatggcattcatttgaacaactttgtcaaactggagaaaaaattgatccg
gttgatttcttcaaaactaccagctcagctaaagcaacccaaccttcaattatcaaaaac
tctgaattttcgcctttcgatttaatttccaactacaaaaatgtatattctgaaaatctc
gatcctgcaaaatctggaccattgtttacatcaactgttgttagtaagccaactttgcaa
gaacatttgtctactgtaaattatgaatggaatgatggagactcagatatgccccctccg
caatcaattgctttaaaaaaaagtcgtgttcctgttaaagcaagacaaagaataattgga
actaaaacttctgatagtcctgtcacaccaaattttggtgttcttcctacggattcacct
gttgttgaattgggctcgtcacctaattttatcacacctccaatatctagccttaatgaa
aatcctttaaaagcaccattaaaggctcctcatcgacagacaacagttaaaatcaacgga
agtcgtcactcatcattaggtttttcttcttttggttcaccttcgcctatttctcagttg
gttgtgacaacaaactgtacttctttacggagaagtaatcgtttatttgattcttctgca
aaggatattaaaaaaacacctcgagttaggtttgcagactcaaataaaccaatcacaact
gctcgtaaaacaaagtctcgcctcactcatgtctcacaaccattaacccctacaattcaa
aacattcaatcagctgctaaaaacgaaaatcttataagtgaaatcaaagatgaaaaaccc
acttcaatttctttatctccaattcaacaaaattcagatatctggatgcgcttatttcaa
gatttgggaaaggcataccatgctctttctatatatgattctaaaaaagcggttgattac
tttagtagtttaccattaaatcaccaaacaaccaattgggtgatggaacagttaggatta
gcatactatgaaatgggtgacataacagcagctcaaaaagtatttgaaaaagttagagaa
aatgatcctgattacatttctgatggaatggcagtgtattcatcacttttatggttatca
cgaaaagactgtgagctttcatgtttggctcaaagtctggttgatagtgacaaaaactct
gcagttgcatggtgtgcaatggctaactgttttagtttacaaaaggaacataatactgca
ataaaatttcttcatcgtgctgttcaacttgaacctgaattttcatatgcttacactctt
ctcggacatgaatatgtttttattgaagattttgacaaagggatatcctgctttcgtact
gctctacgctataatgaaaaacattataatgcttggtatggaataggaatgatatactac
aaacaagacaatttttctatggcaaaattgcattttcaacttgctctcaagataaacccc
agaaattctgtactgctggggcatttagcagtgactcaacacgaacttggagaaacagat
ttagctatggatacaattaataaagcaatagaatataatagcaaaagtgcactttgtaaa
tatcatcgagcaagattctactttgactcagagagactacaggaagctctcgaagaactt
atagaggttaaaaaattggcaccgaaagattcacttatttattacatgattgggaaggtt
tatcaaaagcgtaacgaaattgtattagctcagcaaaatttttcatgggcaatgagttta
aatcctcacggacctaacaacatgataaaggaggcaatgaatcaacttcaaaattattcc
agagaagatattctgactagcgctgttgtcgattcaatggaggacgataacggaatgtct
gacatttctaatagtaacttataa

DBGET integrated database retrieval system