KEGG   Hydra vulgaris: 100197808Help
Entry
100197808         CDS       T01080                                 

Definition
malonyl-CoA decarboxylase, mitochondrial-like
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hmg  Hydra vulgaris
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100197808
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100197808
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100197808
Enzymes [BR:hmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100197808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MLRGLLNVRNYLKSFRLVKNGLKRNSNWVSLLLNKESSHELKIKFSTALSSKRSHESGDL
IPYYFAKDLVSFYNALPNANSKVELFQALSTNLGIDTEQVETSLVKLHKSITEKSTLVNR
NQEELLLSLIPTYKHLFDDISRLSEGVGFLVNMRKDLRHLFKSNLLDRNSPNLRVFDNFL
KKHLAEWFADGFMDLQPITWNSTSAGFIEKLMKSEAVHPINSWSEMKQRMGNRRRVFAFT
HRMIPDEPLVVLHALLGDNIPSNINSVLQTDNYPMEKDLVKTATFYSISAIHRGLDGIGL
GNLLIKKVVHELKREFPTLDTFVTLSPVPNFRKWLDHHLNIVVSGEPIPQTFIGFDMQTC
CDIKNMLSTENWHLNDDLCSKLELPMKKLCARYLSREKRRGLAFDPVAHFHLRNGAILWR
LNWLGNPNQMGMDLSYGLMVNYKYNLTDIEANNYEYLVHSKVATSADVQVTADS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggcttactcaatgtacgtaattatctcaaatcttttcgattggtgaaaaat
ggtttaaagagaaacagtaactgggtatctcttttgctaaataaagagagcagccatgag
ttaaaaataaaattctcaacagcattgtcttcaaaacgaagtcatgaaagtggtgattta
attccttattattttgcaaaagatctggtttcattttataatgcattaccaaatgcgaat
agcaaagttgagttatttcaagcattgtctactaatcttggtattgatactgaacaagtg
gaaaccagtcttgttaagttacataagagcataacagaaaaatcaacattagttaatcga
aatcaagaggagcttttattgagcttaattccaacatataaacatctttttgatgatatc
agcaggttatctgaaggtgttggatttcttgtcaacatgcgaaaagacttaagacatttg
tttaaatcaaatttgcttgatcgcaacagtcctaatctgcgtgtctttgacaattttcta
aaaaaacatcttgctgaatggtttgcagatggttttatggatttacagcctattacttgg
aattcgaccagtgctggatttattgaaaagttaatgaagtctgaagctgttcatcctatt
aattcttggagtgaaatgaagcaacgtatgggtaatagaagaagggtttttgcgtttact
catcgtatgattcctgatgaacccctggttgttttgcatgcactcctcggtgataatata
cccagtaatataaattctgttttgcaaacagataattatccaatggaaaaagatttggtc
aaaacagccacattttactcaatatcagcaatacatagaggattggatggaattggttta
ggaaatcttcttattaaaaaagtagtacacgaacttaagagagagtttccaactcttgat
acatttgtaactttatctcctgtaccaaatttcaggaaatggcttgaccatcatttaaac
attgttgtatcaggggaaccaattcctcaaacatttattggttttgacatgcagacttgt
tgtgatattaagaatatgctttcaactgaaaactggcatttaaatgacgatttgtgtagt
aaactagagcttcccatgaaaaagctttgtgctagatatttgtctagagaaaaaagaaga
ggtttagccttcgaccctgttgctcactttcatcttcgtaatggtgcaatattatggcgt
ttgaattggcttggtaacccaaaccaaatgggcatggatttatcttatgggcttatggtt
aactacaagtataacttgactgatatcgaggcaaataattatgaatatttggtccacagt
aaagtcgctacctccgctgatgttcaagtcactgctgatagttaa

DBGET integrated database retrieval system